List of human transcription factors

This list of manually curated human transcription factors is taken from Lambert, Jolma, Campitelli et al.^[1]
It was assembled by manual curation.
More detailed information is found in the manuscript and the web site accompanying the paper (Human Transcription Factors)

List of human transcription factors (1639)

Gene	ID	DBD	Motif status (Feb 2018) (Link to human TFs annotation)	IUPAC consensus (from selected PWM)
AC008770.3	ENSG00000267179	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1]
AC023509.3	ENSG00000267281	bZIP	Known motif – from protein with 100% identical DBD – in vitro [2]	RTGACGTCAY
AC092835.1	ENSG00000233757	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [3]
AC138696.1	ENSG00000264668	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [4]	RYGGAGAGTTAGC
ADNP	ENSG00000101126	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [5]
ADNP2	ENSG00000101544	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [6]
AEBP1	ENSG00000106624	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [7]
AEBP2	ENSG00000139154	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [8]
AHCTF1	ENSG00000153207	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [9]
AHDC1	ENSG00000126705	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [10]
AHR	ENSG00000106546	bHLH	Known motif – In vivo/Misc source [11]	BKNGCGTGHV
AHRR	ENSG00000063438	bHLH	Inferred motif from similar protein – In vivo/Misc source [12]	BKNGCGTGHV
AIRE	ENSG00000160224	SAND	Known motif – In vivo/Misc source [13]	HNNGGWWNWDWWGGDBDH
AKAP8	ENSG00000105127	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [14]
AKAP8L	ENSG00000011243	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [15]
AKNA	ENSG00000106948	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [16]
ALX1	ENSG00000180318	Homeodomain	Known motif – High-throughput in vitro [17]	TAATYTAATTA
ALX3	ENSG00000156150	Homeodomain	Known motif – High-throughput in vitro [18]	TAATTR
ALX4	ENSG00000052850	Homeodomain	Known motif – High-throughput in vitro [19]	TAATYNRRTTA
ANHX	ENSG00000227059	Homeodomain	Known motif – High-throughput in vitro [20]	KTKACAWG
ANKZF1	ENSG00000163516	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [21]
AR	ENSG00000169083	Nuclear receptor	Known motif – High-throughput in vitro [22]	RGGWACRHBDYGTWCYH
ARGFX	ENSG00000186103	Homeodomain	Known motif – High-throughput in vitro [23]	DYTAATTAR
ARHGAP35	ENSG00000160007	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [24]
ARID2	ENSG00000189079	ARID/BRIGHT; RFX	Likely sequence specific TF according to literature or domain structure – No motif [25]
ARID3A	ENSG00000116017	ARID/BRIGHT	Known motif – from protein with 100% identical DBD – in vitro [26]	DATHAAD
ARID3B	ENSG00000179361	ARID/BRIGHT	Inferred motif from similar protein – High-throughput in vitro [27]	WWTTAATH
ARID3C	ENSG00000205143	ARID/BRIGHT	Inferred motif from similar protein – High-throughput in vitro [28]	DATHAAD
ARID5A	ENSG00000196843	ARID/BRIGHT	Known motif – from protein with 100% identical DBD – in vitro [29]	HAATATTD
ARID5B	ENSG00000150347	ARID/BRIGHT	Known motif – from protein with 100% identical DBD – in vitro [30]	DATWH
ARNT	ENSG00000143437	bHLH	Known motif – from protein with 100% identical DBD – in vitro [31]	KCACGTGM
ARNT2	ENSG00000172379	bHLH	Known motif – High-throughput in vitro [32]	RDCACGTGM
ARNTL	ENSG00000133794	bHLH	Known motif – High-throughput in vitro [33]	GTCACGTGAC
ARNTL2	ENSG00000029153	bHLH	Inferred motif from similar protein – High-throughput in vitro [34]	CACGTGAY
ARX	ENSG00000004848	Homeodomain	Known motif – High-throughput in vitro [35]	TAATYNRATTA
ASCL1	ENSG00000139352	bHLH	Known motif – High-throughput in vitro [36]	RCASSTGY
ASCL2	ENSG00000183734	bHLH	Known motif – High-throughput in vitro [37]	RCAGCTGY
ASCL3	ENSG00000176009	bHLH	Inferred motif from similar protein – High-throughput in vitro [38]	RCASSTGY
ASCL4	ENSG00000187855	bHLH	Inferred motif from similar protein – High-throughput in vitro [39]	RCASSTGY
ASCL5	ENSG00000232237	bHLH	Inferred motif from similar protein – High-throughput in vitro [40]	RCASSTGY
ASH1L	ENSG00000116539	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [41]
ATF1	ENSG00000123268	bZIP	Known motif – In vivo/Misc source [42]	VTGACGTSAV
ATF2	ENSG00000115966	bZIP	Known motif – High-throughput in vitro [43]	VTKACGTMAB
ATF3	ENSG00000162772	bZIP	Known motif – High-throughput in vitro [44]	RTGACGTCAY
ATF4	ENSG00000128272	bZIP	Known motif – High-throughput in vitro [45]	RKATGACGTCATMY
ATF5	ENSG00000169136	bZIP	Known motif – In vivo/Misc source [46]	WAAGGRAGARR
ATF6	ENSG00000118217	bZIP	Known motif – High-throughput in vitro [47]	YKRTGACGTGGCA
ATF6B	ENSG00000213676	bZIP	Known motif – High-throughput in vitro [48]	RTGACGTGGCR
ATF7	ENSG00000170653	bZIP	Known motif – High-throughput in vitro [49]	DRTGACGTCAT
ATMIN	ENSG00000166454	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [50]
ATOH1	ENSG00000172238	bHLH	Known motif – High-throughput in vitro [51]	RACAGCTGYY
ATOH7	ENSG00000179774	bHLH	Known motif – High-throughput in vitro [52]	RVCATATGBT
ATOH8	ENSG00000168874	bHLH	Inferred motif from similar protein – High-throughput in vitro [53]	AAWTANNNBRMCATATGKY
BACH1	ENSG00000156273	bZIP	Known motif – In vivo/Misc source [54]	RTGACTCAGCANWWH
BACH2	ENSG00000112182	bZIP	Known motif – High-throughput in vitro [55]	WDNSATGASTCATGNWW
BARHL1	ENSG00000125492	Homeodomain	Known motif – High-throughput in vitro [56]	TAAWYG
BARHL2	ENSG00000143032	Homeodomain	Known motif – High-throughput in vitro [57]	TAAWBG
BARX1	ENSG00000131668	Homeodomain	Known motif – High-throughput in vitro [58]	TAATBGNWWWTTAATBR
BARX2	ENSG00000043039	Homeodomain	Known motif – High-throughput in vitro [59]	TAAYKRTTWW
BATF	ENSG00000156127	bZIP	Known motif – High-throughput in vitro [60]	VVYGMCAC
BATF2	ENSG00000168062	bZIP	Likely sequence specific TF according to literature or domain structure – No motif [61]
BATF3	ENSG00000123685	bZIP	Known motif – High-throughput in vitro [62]	VTGACGTCAYV
BAZ2A	ENSG00000076108	MBD; AT hook	Likely sequence specific TF according to literature or domain structure – No motif [63]
BAZ2B	ENSG00000123636	MBD	Likely sequence specific TF according to literature or domain structure – No motif [64]
BBX	ENSG00000114439	HMG/Sox	Known motif – High-throughput in vitro [65]	TGAWCDNYGWTCA
BCL11A	ENSG00000119866	C2H2 ZF	Known motif – In vivo/Misc source [66]	DDRRGGAASTGARAV
BCL11B	ENSG00000127152	C2H2 ZF	Known motif – High-throughput in vitro [67]	GTGAACGBNDNNVCTACAC
BCL6	ENSG00000113916	C2H2 ZF	Known motif – High-throughput in vitro [68]	YGCTTTCKAGGAAH
BCL6B	ENSG00000161940	C2H2 ZF	Known motif – High-throughput in vitro [69]	GCTTTCKAGGAAH
BHLHA15	ENSG00000180535	bHLH	Known motif – High-throughput in vitro [70]	VCATATGB
BHLHA9	ENSG00000205899	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [71]
BHLHE22	ENSG00000180828	bHLH	Known motif – High-throughput in vitro [72]	AVCATATGBT
BHLHE23	ENSG00000125533	bHLH	Known motif – High-throughput in vitro [73]	AVCATATGBY
BHLHE40	ENSG00000134107	bHLH	Known motif – High-throughput in vitro [74]	DKCACGTGM
BHLHE41	ENSG00000123095	bHLH	Known motif – High-throughput in vitro [75]	RKCACGTGAY
BNC1	ENSG00000169594	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [76]	CCRCCWTCA
BNC2	ENSG00000173068	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [77]	CCRCCWTCA
BORCS8-MEF2B	ENSG00000064489	MADS box	Known motif – from protein with 100% identical DBD – in vitro [78]	CCDWWWHNRG
BPTF	ENSG00000171634	Unknown	Known motif – In vivo/Misc source [79]	KKKNTTGTKKNV
BRF2	ENSG00000104221	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [80]
BSX	ENSG00000188909	Homeodomain	Known motif – High-throughput in vitro [81]	TAATBR
C11orf95	ENSG00000188070	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [82]
CAMTA1	ENSG00000171735	CG-1	Likely sequence specific TF according to literature or domain structure – No motif [83]
CAMTA2	ENSG00000108509	CG-1	Likely sequence specific TF according to literature or domain structure – No motif [84]
CARF	ENSG00000138380	Unknown	Known motif – In vivo/Misc source [85]	GCCTCGTTYTSR
CASZ1	ENSG00000130940	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [86]
CBX2	ENSG00000173894	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [87]
CC2D1A	ENSG00000132024	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [88]
CCDC169-SOHLH2	ENSG00000250709	bHLH	Known motif – from protein with 100% identical DBD – in vitro [89]	BCACGTGC
CCDC17	ENSG00000159588	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [90]
CDC5L	ENSG00000096401	Myb/SANT	Known motif – In vivo/Misc source [91]	VBGWKDTAAYRWAWB
CDX1	ENSG00000113722	Homeodomain	Known motif – High-throughput in vitro [92]	TTTATKRB
CDX2	ENSG00000165556	Homeodomain	Known motif – High-throughput in vitro [93]	DWWATKRB
CDX4	ENSG00000131264	Homeodomain	Known motif – High-throughput in vitro [94]	VKTTTATKRCH
CEBPA	ENSG00000245848	bZIP	Known motif – from protein with 100% identical DBD – in vitro [95]	TTGCGHAA
CEBPB	ENSG00000172216	bZIP	Known motif – High-throughput in vitro [96]	VTTRCGCAAY
CEBPD	ENSG00000221869	bZIP	Known motif – High-throughput in vitro [97]	VTTRCGCAAY
CEBPE	ENSG00000092067	bZIP	Known motif – High-throughput in vitro [98]	VTTRCGCAAY
CEBPG	ENSG00000153879	bZIP	Known motif – High-throughput in vitro [99]	RTTRCGCAAY
CEBPZ	ENSG00000115816	Unknown	Known motif – In vivo/Misc source [100]	DSTSATTGGCT
CENPA	ENSG00000115163	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [101]
CENPB	ENSG00000125817	CENPB	Known motif – High-throughput in vitro [102]	TWCGYNNNAHRCGGG
CENPBD1	ENSG00000177946	CENPB	Known motif – High-throughput in vitro [103]	WNYGWAD
CENPS	ENSG00000175279	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [104]
CENPT	ENSG00000102901	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [105]
CENPX	ENSG00000169689	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [106]
CGGBP1	ENSG00000163320	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [107]
CHAMP1	ENSG00000198824	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [108]
CHCHD3	ENSG00000106554	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [109]
CIC	ENSG00000079432	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [110]	VTCAGCA
CLOCK	ENSG00000134852	bHLH	Known motif – High-throughput in vitro [111]	DACACGTGYH
CPEB1	ENSG00000214575	Unknown	Known motif – High-throughput in vitro [112]	HTTTTATH
CPXCR1	ENSG00000147183	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [113]
CREB1	ENSG00000118260	bZIP	Known motif – High-throughput in vitro [114]	VTKACGTMA
CREB3	ENSG00000107175	bZIP	Known motif – High-throughput in vitro [115]	RTGACGTGKH
CREB3L1	ENSG00000157613	bZIP	Known motif – High-throughput in vitro [116]	TGCCACGTGGCR
CREB3L2	ENSG00000182158	bZIP	Known motif – from protein with 100% identical DBD – in vitro [117]	HCACGTGKM
CREB3L3	ENSG00000060566	bZIP	Likely sequence specific TF according to literature or domain structure – No motif [118]
CREB3L4	ENSG00000143578	bZIP	Known motif – High-throughput in vitro [119]	VTGACGTGGM
CREB5	ENSG00000146592	bZIP	Known motif – High-throughput in vitro [120]	VTKACRTMAB
CREBL2	ENSG00000111269	bZIP	Inferred motif from similar protein – High-throughput in vitro [121]	ATKACGTMAY
CREBZF	ENSG00000137504	bZIP	Inferred motif from similar protein – High-throughput in vitro [122]	WWACGTWD
CREM	ENSG00000095794	bZIP	Known motif – High-throughput in vitro [123]	VVTBACGTVAB
CRX	ENSG00000105392	Homeodomain	Known motif – High-throughput in vitro [124]	TAATCC
CSRNP1	ENSG00000144655	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [125]
CSRNP2	ENSG00000110925	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [126]
CSRNP3	ENSG00000178662	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [127]
CTCF	ENSG00000102974	C2H2 ZF	Known motif – High-throughput in vitro [128]	CCDSBAGGKGGCGCB
CTCFL	ENSG00000124092	C2H2 ZF	Known motif – In vivo/Misc source [129]	CCNSYAGGGGGCGCY
CUX1	ENSG00000257923	CUT; Homeodomain	Known motif – High-throughput in vitro [130]	ATYGATHA
CUX2	ENSG00000111249	CUT; Homeodomain	Known motif – High-throughput in vitro [131]	DDATYGATYA
CXXC1	ENSG00000154832	CxxC	Known motif – High-throughput in vitro [132]	BCG
CXXC4	ENSG00000168772	CxxC	Likely sequence specific TF according to literature or domain structure – No motif [133]
CXXC5	ENSG00000171604	CxxC	Known motif – High-throughput in vitro [134]	DCK
DACH1	ENSG00000276644	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [135]
DACH2	ENSG00000126733	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [136]
DBP	ENSG00000105516	bZIP	Known motif – High-throughput in vitro [137]	RTTAYRTAAB
DBX1	ENSG00000109851	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [138]	WTTAATTA
DBX2	ENSG00000185610	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [139]	AH
DDIT3	ENSG00000175197	bZIP	Known motif – In vivo/Misc source [140]	RVVKATTGCANNB
DEAF1	ENSG00000177030	SAND	Inferred motif from similar protein – In vivo/Misc source [141]	VCRBNYYCGKGDRYTTCCGDVDNNB
DLX1	ENSG00000144355	Homeodomain	Known motif – High-throughput in vitro [142]	TAATTR
DLX2	ENSG00000115844	Homeodomain	Known motif – High-throughput in vitro [143]	TAATTR
DLX3	ENSG00000064195	Homeodomain	Known motif – High-throughput in vitro [144]	TAATTR
DLX4	ENSG00000108813	Homeodomain	Known motif – High-throughput in vitro [145]	TAATTR
DLX5	ENSG00000105880	Homeodomain	Known motif – High-throughput in vitro [146]	TAATTR
DLX6	ENSG00000006377	Homeodomain	Known motif – High-throughput in vitro [147]	TAATTR
DMBX1	ENSG00000197587	Homeodomain	Known motif – High-throughput in vitro [148]	HTAATCCB
DMRT1	ENSG00000137090	DM	Known motif – High-throughput in vitro [149]	GHWACWH
DMRT2	ENSG00000173253	DM	Known motif – High-throughput in vitro [150]	DATAMATT
DMRT3	ENSG00000064218	DM	Known motif – High-throughput in vitro [151]	DWWTTGWTACAWT
DMRTA1	ENSG00000176399	DM	Known motif – High-throughput in vitro [152]	DDWTGHTACAW
DMRTA2	ENSG00000142700	DM	Known motif – High-throughput in vitro [153]	DHBGHWACADB
DMRTB1	ENSG00000143006	DM	Likely sequence specific TF according to literature or domain structure – No motif [154]
DMRTC2	ENSG00000142025	DM	Known motif – High-throughput in vitro [155]	WWTTGHTACAW
DMTF1	ENSG00000135164	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [156]
DNMT1	ENSG00000130816	CxxC	Known motif – High-throughput in vitro [157]	CGG
DNTTIP1	ENSG00000101457	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [158]
DOT1L	ENSG00000104885	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [159]
DPF1	ENSG00000011332	C2H2 ZF	Known motif – High-throughput in vitro [160]	KMTATAGGBG
DPF3	ENSG00000205683	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [161]	KMTATAGGBG
DPRX	ENSG00000204595	Homeodomain	Known motif – High-throughput in vitro [162]	RGMTAATCY
DR1	ENSG00000117505	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [163]
DRAP1	ENSG00000175550	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [164]
DRGX	ENSG00000165606	Homeodomain	Known motif – High-throughput in vitro [165]	TAATYNAATTA
DUX1	DUX1_HUMAN	Homeodomain	Known motif – In vivo/Misc source [166]	ATAATCTGATTAT
DUX3	DUX3_HUMAN	Homeodomain	Known motif – In vivo/Misc source [167]	TTAATTAAATTAA
DUX4	ENSG00000260596	Homeodomain	Known motif – In vivo/Misc source [168]	TGATTRRRTTA
DUXA	ENSG00000258873	Homeodomain	Known motif – High-throughput in vitro [169]	TGATTRVRTYD
DZIP1	ENSG00000134874	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [170]
E2F1	ENSG00000101412	E2F	Known motif – High-throughput in vitro [171]	WTTGGCGCCHWW
E2F2	ENSG00000007968	E2F	Known motif – High-throughput in vitro [172]	WDWWGGCGCCHWWH
E2F3	ENSG00000112242	E2F	Known motif – High-throughput in vitro [173]	TTTTGGCGCCMTTTTY
E2F4	ENSG00000205250	E2F	Known motif – High-throughput in vitro [174]	TTTGGCGCCAAA
E2F5	ENSG00000133740	E2F	Known motif – In vivo/Misc source [175]	TTTSGCGC
E2F6	ENSG00000169016	E2F	Known motif – In vivo/Misc source [176]	DGGMGGGARV
E2F7	ENSG00000165891	E2F	Known motif – High-throughput in vitro [177]	WTTTGGCGGGAAAH
E2F8	ENSG00000129173	E2F	Known motif – High-throughput in vitro [178]	TTTGGCGGGAAA
E4F1	ENSG00000167967	C2H2 ZF	Known motif – In vivo/Misc source [179]	RTGACGTARS
EBF1	ENSG00000164330	EBF1	Known motif – High-throughput in vitro [180]	ANTCCCHWGGGAHH
EBF2	ENSG00000221818	EBF1	Known motif – In vivo/Misc source [181]	VTGMAACCCCCWWTHVK
EBF3	ENSG00000108001	EBF1	Known motif – In vivo/Misc source [182]	BTCCCYWGRGD
EBF4	ENSG00000088881	EBF1	Known motif – In vivo/Misc source [183]	CGSATAACCMTTGTTATCAB
EEA1	ENSG00000102189	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [184]
EGR1	ENSG00000120738	C2H2 ZF	Known motif – High-throughput in vitro [185]	MCGCCCMCGCA
EGR2	ENSG00000122877	C2H2 ZF	Known motif – High-throughput in vitro [186]	MCGCCCACGCD
EGR3	ENSG00000179388	C2H2 ZF	Known motif – High-throughput in vitro [187]	HMCGCCCMCGCAH
EGR4	ENSG00000135625	C2H2 ZF	Known motif – High-throughput in vitro [188]	HMCGCCCACGCAH
EHF	ENSG00000135373	Ets	Known motif – High-throughput in vitro [189]	ACCCGGAAGTD
ELF1	ENSG00000120690	Ets	Known motif – High-throughput in vitro [190]	WHSCGGAAGY
ELF2	ENSG00000109381	Ets	Known motif – High-throughput in vitro [191]	AMCCGGAAGTV
ELF3	ENSG00000163435	Ets; AT hook	Known motif – High-throughput in vitro [192]	WACCCGGAAGTR
ELF4	ENSG00000102034	Ets	Known motif – High-throughput in vitro [193]	ABSCGGAAGTR
ELF5	ENSG00000135374	Ets	Known motif – High-throughput in vitro [194]	WNVMGGAARY
ELK1	ENSG00000126767	Ets	Known motif – High-throughput in vitro [195]	RCCGGAAGT
ELK3	ENSG00000111145	Ets	Known motif – High-throughput in vitro [196]	RCCGGAAGT
ELK4	ENSG00000158711	Ets	Known motif – High-throughput in vitro [197]	ACCGGAARY
EMX1	ENSG00000135638	Homeodomain	Known motif – High-throughput in vitro [198]	BTAATTR
EMX2	ENSG00000170370	Homeodomain	Known motif – High-throughput in vitro [199]	BTAATTA
EN1	ENSG00000163064	Homeodomain	Known motif – High-throughput in vitro [200]	TAATTRVB
EN2	ENSG00000164778	Homeodomain	Known motif – High-throughput in vitro [201]	TAATTR
EOMES	ENSG00000163508	T-box	Known motif – High-throughput in vitro [202]	WTCACACCTH
EPAS1	ENSG00000116016	bHLH	Known motif – In vivo/Misc source [203]	VDACGTGHH
ERF	ENSG00000105722	Ets	Known motif – High-throughput in vitro [204]	ACCGGAARTV
ERG	ENSG00000157554	Ets	Known motif – High-throughput in vitro [205]	ACCGGAARY
ESR1	ENSG00000091831	Nuclear receptor	Known motif – High-throughput in vitro [206]	AGGTCAYSRTGACCT
ESR2	ENSG00000140009	Nuclear receptor	Known motif – from protein with 100% identical DBD – in vitro [207]	RGGTCAH
ESRRA	ENSG00000173153	Nuclear receptor	Known motif – High-throughput in vitro [208]	SAAGGTCA
ESRRB	ENSG00000119715	Nuclear receptor	Known motif – High-throughput in vitro [209]	TCAAGGTCAWH
ESRRG	ENSG00000196482	Nuclear receptor	Known motif – High-throughput in vitro [210]	SAAGGTCR
ESX1	ENSG00000123576	Homeodomain	Known motif – High-throughput in vitro [211]	TAATTR
ETS1	ENSG00000134954	Ets	Known motif – High-throughput in vitro [212]	RCCGGAWRYRYWTCCGSH
ETS2	ENSG00000157557	Ets	Known motif – High-throughput in vitro [213]	ACCGGAWGYRCWTCCGGT
ETV1	ENSG00000006468	Ets	Known motif – High-throughput in vitro [214]	RCCGGAWRY
ETV2	ENSG00000105672	Ets	Known motif – High-throughput in vitro [215]	DACCGGAARYD
ETV3	ENSG00000117036	Ets	Known motif – High-throughput in vitro [216]	AHCGGAWWTCCGNT
ETV3L	ENSG00000253831	Ets	Known motif – from protein with 100% identical DBD – in vitro [217]	VGGAWR
ETV4	ENSG00000175832	Ets	Known motif – High-throughput in vitro [218]	RCCGGAWGY
ETV5	ENSG00000244405	Ets	Known motif – High-throughput in vitro [219]	DVCGGAWRY
ETV6	ENSG00000139083	Ets	Known motif – High-throughput in vitro [220]	SCGGAASCGGAAGYR
ETV7	ENSG00000010030	Ets	Known motif – High-throughput in vitro [221]	VVGGAAGYRCTTCCBB
EVX1	ENSG00000106038	Homeodomain	Known motif – High-throughput in vitro [222]	TAATBRB
EVX2	ENSG00000174279	Homeodomain	Known motif – High-throughput in vitro [223]	TAATBRB
FAM170A	ENSG00000164334	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [224]
FAM200B	ENSG00000237765	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [225]
FBXL19	ENSG00000099364	CxxC	Likely sequence specific TF according to literature or domain structure – No motif [226]
FERD3L	ENSG00000146618	bHLH	Known motif – High-throughput in vitro [227]	GYRMCAGCTGTBRC
FEV	ENSG00000163497	Ets	Known motif – High-throughput in vitro [228]	ACCGGAART
FEZF1	ENSG00000128610	C2H2 ZF	Known motif – High-throughput in vitro [229]	AAAARRRCAV
FEZF2	ENSG00000153266	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [230]	AAAWGAGCAATCA
FIGLA	ENSG00000183733	bHLH	Known motif – High-throughput in vitro [231]	MCAGGTGKD
FIZ1	ENSG00000179943	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [232]
FLI1	ENSG00000151702	Ets	Known motif – High-throughput in vitro [233]	RCCGGAWRY
FLYWCH1	ENSG00000059122	FLYWCH	Likely sequence specific TF according to literature or domain structure – No motif [234]
FOS	ENSG00000170345	bZIP	Known motif – High-throughput in vitro [235]	BRTGACGTCAYV
FOSB	ENSG00000125740	bZIP	Known motif – High-throughput in vitro [236]	RTGACGTCAY
FOSL1	ENSG00000175592	bZIP	Known motif – High-throughput in vitro [237]	DRTGAYRCR
FOSL2	ENSG00000075426	bZIP	Known motif – High-throughput in vitro [238]	TKANTCAYNRTGACGTCAY
FOXA1	ENSG00000129514	Forkhead	Known motif – High-throughput in vitro [239]	BVYTAWGTAAACAAW
FOXA2	ENSG00000125798	Forkhead	Known motif – High-throughput in vitro [240]	HNNGTMAATATTKRYNBD
FOXA3	ENSG00000170608	Forkhead	Known motif – High-throughput in vitro [241]	BVYTAWGTAAACAAA
FOXB1	ENSG00000171956	Forkhead	Known motif – High-throughput in vitro [242]	WRWGTMAATATTKACWYW
FOXB2	ENSG00000204612	Forkhead	Inferred motif from similar protein – High-throughput in vitro [243]	HWRWGYMAATATTKRCHYW
FOXC1	ENSG00000054598	Forkhead	Known motif – High-throughput in vitro [244]	WRWRTMAAYAW
FOXC2	ENSG00000176692	Forkhead	Known motif – High-throughput in vitro [245]	WAHRTMAAYAWW
FOXD1	ENSG00000251493	Forkhead	Known motif – from protein with 100% identical DBD – in vitro [246]	HWASAATAAYAWW
FOXD2	ENSG00000186564	Forkhead	Known motif – High-throughput in vitro [247]	RTAAAYA
FOXD3	ENSG00000187140	Forkhead	Known motif – High-throughput in vitro [248]	RTAAAYA
FOXD4	ENSG00000170122	Forkhead	Inferred motif from similar protein – In vivo/Misc source [249]	GTTAAAGCVAKTTTAA
FOXD4L1	ENSG00000184492	Forkhead	Inferred motif from similar protein – In vivo/Misc source [250]	GTTAAAGCVAKTTTAA
FOXD4L3	ENSG00000187559	Forkhead	Inferred motif from similar protein – In vivo/Misc source [251]	MGGTAAATCMAGGGWWT
FOXD4L4	ENSG00000184659	Forkhead	Known motif – In vivo/Misc source [252]	MGGTAAATCMAGGGWWT
FOXD4L5	ENSG00000204779	Forkhead	Inferred motif from similar protein – In vivo/Misc source [253]	MGGTAAATCMAGGGWWT
FOXD4L6	ENSG00000273514	Forkhead	Inferred motif from similar protein – In vivo/Misc source [254]	MGGTAAATCMAGGGWWT
FOXE1	ENSG00000178919	Forkhead	Known motif – High-throughput in vitro [255]	BVYTAWRYAAACAD
FOXE3	ENSG00000186790	Forkhead	Inferred motif from similar protein – High-throughput in vitro [256]	BVYTAWRYAAACAD
FOXF1	ENSG00000103241	Forkhead	Known motif – In vivo/Misc source [257]	YRHATAAACAHNB
FOXF2	ENSG00000137273	Forkhead	Known motif – In vivo/Misc source [258]	BNHNBRTAAACAHNV
FOXG1	ENSG00000176165	Forkhead	Known motif – High-throughput in vitro [259]	RTAAACAH
FOXH1	ENSG00000160973	Forkhead	Known motif – In vivo/Misc source [260]	BNSAATMCACA
FOXI1	ENSG00000168269	Forkhead	Known motif – High-throughput in vitro [261]	RTMAACA
FOXI2	ENSG00000186766	Forkhead	Inferred motif from similar protein – High-throughput in vitro [262]	RTMAACA
FOXI3	ENSG00000214336	Forkhead	Inferred motif from similar protein – High-throughput in vitro [263]	RTMAACA
FOXJ1	ENSG00000129654	Forkhead	Known motif – from protein with 100% identical DBD – in vitro [264]	HAAACAAA
FOXJ2	ENSG00000065970	Forkhead	Known motif – High-throughput in vitro [265]	GTAAACAWMAACA
FOXJ3	ENSG00000198815	Forkhead	Known motif – High-throughput in vitro [266]	RTAAACAW
FOXK1	ENSG00000164916	Forkhead	Known motif – High-throughput in vitro [267]	RWMMAYA
FOXK2	ENSG00000141568	Forkhead	Inferred motif from similar protein – High-throughput in vitro [268]	RWMAACAA
FOXL1	ENSG00000176678	Forkhead	Known motif – High-throughput in vitro [269]	RTAAACA
FOXL2	ENSG00000183770	Forkhead	Known motif – High-throughput in vitro [270]	VBGHMAACAH
FOXM1	ENSG00000111206	Forkhead	Known motif – from protein with 100% identical DBD – in vitro [271]	RWHR
FOXN1	ENSG00000109101	Forkhead	Known motif – In vivo/Misc source [272]	WVBSACGCB
FOXN2	ENSG00000170802	Forkhead	Known motif – High-throughput in vitro [273]	GCGTSNNNNNSACGC
FOXN3	ENSG00000053254	Forkhead	Known motif – High-throughput in vitro [274]	GTAAACAA
FOXN4	ENSG00000139445	Forkhead	Known motif – In vivo/Misc source [275]	WHNWRRNGACGCYATNHM
FOXO1	ENSG00000150907	Forkhead	Known motif – High-throughput in vitro [276]	RTAAACATGTTTAC
FOXO3	ENSG00000118689	Forkhead	Known motif – High-throughput in vitro [277]	GTAAACAW
FOXO4	ENSG00000184481	Forkhead	Known motif – High-throughput in vitro [278]	GTAAACA
FOXO6	ENSG00000204060	Forkhead	Known motif – High-throughput in vitro [279]	GTAAACATGTTTAC
FOXP1	ENSG00000114861	Forkhead	Known motif – High-throughput in vitro [280]	TGTTTRYNRTNNNNNNBNAYRVWMAACA
FOXP2	ENSG00000128573	Forkhead	Known motif – High-throughput in vitro [281]	RTAAAYAW
FOXP3	ENSG00000049768	Forkhead	Known motif – High-throughput in vitro [282]	RTAAACA
FOXP4	ENSG00000137166	Forkhead	Inferred motif from similar protein – High-throughput in vitro [283]	RTMAAYA
FOXQ1	ENSG00000164379	Forkhead	Known motif – High-throughput in vitro [284]	YWRHRTAAACWD
FOXR1	ENSG00000176302	Forkhead	Known motif – High-throughput in vitro [285]	CAADY
FOXR2	ENSG00000189299	Forkhead	Known motif – High-throughput in vitro [286]	RYRTAWACATAAAWRHH
FOXS1	ENSG00000179772	Forkhead	Inferred motif from similar protein – High-throughput in vitro [287]	HNNRHMAAYA
GABPA	ENSG00000154727	Ets	Known motif – High-throughput in vitro [288]	RSCGGAWRY
GATA1	ENSG00000102145	GATA	Known motif – High-throughput in vitro [289]	GATWASMH
GATA2	ENSG00000179348	GATA	Known motif – High-throughput in vitro [290]	VHGATAHSV
GATA3	ENSG00000107485	GATA	Known motif – High-throughput in vitro [291]	HGATAAVV
GATA4	ENSG00000136574	GATA	Known motif – High-throughput in vitro [292]	HGATAAVV
GATA5	ENSG00000130700	GATA	Known motif – High-throughput in vitro [293]	HGATAASV
GATA6	ENSG00000141448	GATA	Known motif – High-throughput in vitro [294]	HGATAABVATCD
GATAD2A	ENSG00000167491	GATA	Likely sequence specific TF according to literature or domain structure – No motif [295]
GATAD2B	ENSG00000143614	GATA	Likely sequence specific TF according to literature or domain structure – No motif [296]
GBX1	ENSG00000164900	Homeodomain	Known motif – High-throughput in vitro [297]	BTAATTRSB
GBX2	ENSG00000168505	Homeodomain	Known motif – High-throughput in vitro [298]	TAATTR
GCM1	ENSG00000137270	GCM	Known motif – High-throughput in vitro [299]	BATGCGGGTRS
GCM2	ENSG00000124827	GCM	Known motif – High-throughput in vitro [300]	HRCCCGCAT
GFI1	ENSG00000162676	C2H2 ZF	Known motif – High-throughput in vitro [301]	BMAATCACDGCNHBBCACTM
GFI1B	ENSG00000165702	C2H2 ZF	Known motif – High-throughput in vitro [302]	MAATCASDGCNNBBCACT
GLI1	ENSG00000111087	C2H2 ZF	Known motif – In vivo/Misc source [303]	SMCCHCCCA
GLI2	ENSG00000074047	C2H2 ZF	Known motif – High-throughput in vitro [304]	GMCCACMCANVNHB
GLI3	ENSG00000106571	C2H2 ZF	Known motif – High-throughput in vitro [305]	VGACCACCCACVNHG
GLI4	ENSG00000250571	C2H2 ZF	Known motif – In vivo/Misc source [306]	RRGCCTTGAATGCCANGNYMA
GLIS1	ENSG00000174332	C2H2 ZF	Known motif – High-throughput in vitro [307]	MGACCCCCCACGWHG
GLIS2	ENSG00000126603	C2H2 ZF	Known motif – High-throughput in vitro [308]	KACCCCCCRCRDHG
GLIS3	ENSG00000107249	C2H2 ZF	Known motif – High-throughput in vitro [309]	KACCCCCCACRAAG
GLMP	ENSG00000198715	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [310]
GLYR1	ENSG00000140632	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [311]
GMEB1	ENSG00000162419	SAND	Known motif – High-throughput in vitro [312]	KTACGTAMNKTACGTMM
GMEB2	ENSG00000101216	SAND	Known motif – High-throughput in vitro [313]	YBACGYAM
GPBP1	ENSG00000062194	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [314]
GPBP1L1	ENSG00000159592	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [315]
GRHL1	ENSG00000134317	Grainyhead	Known motif – High-throughput in vitro [316]	DAACCGGTTH
GRHL2	ENSG00000083307	Grainyhead	Known motif – In vivo/Misc source [317]	RAACHDGHHHDDCHDGTTY
GRHL3	ENSG00000158055	Grainyhead	Likely sequence specific TF according to literature or domain structure – No motif [318]
GSC	ENSG00000133937	Homeodomain	Known motif – High-throughput in vitro [319]	HTAATCC
GSC2	ENSG00000063515	Homeodomain	Known motif – High-throughput in vitro [320]	HTAATCCBH
GSX1	ENSG00000169840	Homeodomain	Known motif – High-throughput in vitro [321]	TAATKR
GSX2	ENSG00000180613	Homeodomain	Known motif – High-throughput in vitro [322]	TAATKR
GTF2B	ENSG00000137947	Unknown	Known motif – In vivo/Misc source [323]	STYWYAKASTS
GTF2I	ENSG00000263001	GTF2I-like	Known motif – In vivo/Misc source [324]	VAGVDVKTSH
GTF2IRD1	ENSG00000006704	GTF2I-like	Known motif – In vivo/Misc source [325]	TRTCGCWG
GTF2IRD2	ENSG00000196275	GTF2I-like	Likely sequence specific TF according to literature or domain structure – No motif [326]
GTF2IRD2B	ENSG00000174428	GTF2I-like	Likely sequence specific TF according to literature or domain structure – No motif [327]
GTF3A	ENSG00000122034	C2H2 ZF	Known motif – High-throughput in vitro [328]	GGATGGGAG
GZF1	ENSG00000125812	C2H2 ZF	Known motif – In vivo/Misc source [329]	TATAKAVGCGCA
HAND1	ENSG00000113196	bHLH	Known motif – In vivo/Misc source [330]	DBRTCTGGHWDH
HAND2	ENSG00000164107	bHLH	Known motif – High-throughput in vitro [331]	HVCAGGTGTK
HBP1	ENSG00000105856	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [332]	DD
HDX	ENSG00000165259	Homeodomain	Known motif – High-throughput in vitro [333]	H
HELT	ENSG00000187821	bHLH	Inferred motif from similar protein – High-throughput in vitro [334]	BBCACGTGY
HES1	ENSG00000114315	bHLH	Known motif – High-throughput in vitro [335]	KDCRCGTGBB
HES2	ENSG00000069812	bHLH	Known motif – High-throughput in vitro [336]	VRCACGTGCC
HES3	ENSG00000173673	bHLH	Inferred motif from similar protein – High-throughput in vitro [337]	KDCRCGTGBB
HES4	ENSG00000188290	bHLH	Inferred motif from similar protein – High-throughput in vitro [338]	KDCRCGTGBB
HES5	ENSG00000197921	bHLH	Known motif – High-throughput in vitro [339]	HGGCACGTGYCR
HES6	ENSG00000144485	bHLH	Known motif – High-throughput in vitro [340]	DACACGTGCC
HES7	ENSG00000179111	bHLH	Known motif – High-throughput in vitro [341]	YGGCACGTGCCR
HESX1	ENSG00000163666	Homeodomain	Known motif – High-throughput in vitro [342]	HTAATTRVH
HEY1	ENSG00000164683	bHLH	Known motif – High-throughput in vitro [343]	BBCRCGYGY
HEY2	ENSG00000135547	bHLH	Known motif – High-throughput in vitro [344]	BCACGTGB
HEYL	ENSG00000163909	bHLH	Inferred motif from similar protein – High-throughput in vitro [345]	BCACGTGB
HHEX	ENSG00000152804	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [346]	ATND
HIC1	ENSG00000177374	C2H2 ZF	Known motif – High-throughput in vitro [347]	RTGCCMMC
HIC2	ENSG00000169635	C2H2 ZF	Known motif – High-throughput in vitro [348]	BKGGCAY
HIF1A	ENSG00000100644	bHLH	Known motif – In vivo/Misc source [349]	VVNGCACGTMBNS
HIF3A	ENSG00000124440	bHLH	Inferred motif from similar protein – In vivo/Misc source [350]	RWAWWTMATAWCST
HINFP	ENSG00000172273	C2H2 ZF	Known motif – High-throughput in vitro [351]	GCGGACGYTRSRRCGTCCGC
HIVEP1	ENSG00000095951	C2H2 ZF	Known motif – In vivo/Misc source [352]	KGRRRARTCCCB
HIVEP2	ENSG00000010818	C2H2 ZF	Known motif – In vivo/Misc source [353]	KBYDNGGHAABNSS
HIVEP3	ENSG00000127124	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [354]	KBYDNGGHAABNSS
HKR1	ENSG00000181666	C2H2 ZF	Known motif – High-throughput in vitro [355]	VBKVRVNRDGGAGGRBVNVR
HLF	ENSG00000108924	bZIP	Known motif – High-throughput in vitro [356]	VTTAYRTAAY
HLX	ENSG00000136630	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [357]	AWND
HMBOX1	ENSG00000147421	Homeodomain	Known motif – High-throughput in vitro [358]	VYTAGTTAMV
HMG20A	ENSG00000140382	HMG/Sox	Likely sequence specific TF according to literature or domain structure – No motif [359]
HMG20B	ENSG00000064961	HMG/Sox	Inferred motif from similar protein – High-throughput in vitro [360]	WDWATAAT
HMGA1	ENSG00000137309	AT hook	Known motif – In vivo/Misc source [361]	WATTWW
HMGA2	ENSG00000149948	AT hook	Known motif – In vivo/Misc source [362]	ATATTSSSSDWWAWT
HMGN3	ENSG00000118418	HMG/Sox	Likely sequence specific TF according to literature or domain structure – No motif [363]
HMX1	ENSG00000215612	Homeodomain	Known motif – High-throughput in vitro [364]	TTAAKTGNY
HMX2	ENSG00000188816	Homeodomain	Known motif – High-throughput in vitro [365]	TTAAKTG
HMX3	ENSG00000188620	Homeodomain	Known motif – High-throughput in vitro [366]	TAAKTG
HNF1A	ENSG00000135100	Homeodomain	Known motif – High-throughput in vitro [367]	GTTAATNATTAAY
HNF1B	ENSG00000275410	Homeodomain	Known motif – High-throughput in vitro [368]	GTTAATNATTAAY
HNF4A	ENSG00000101076	Nuclear receptor	Known motif – High-throughput in vitro [369]	VRGGTCAAAGTCCA
HNF4G	ENSG00000164749	Nuclear receptor	Known motif – In vivo/Misc source [370]	GDNCAAAGKYCA
HOMEZ	ENSG00000215271	Homeodomain	Known motif – High-throughput in vitro [371]	WWWAATCGTTTW
HOXA1	ENSG00000105991	Homeodomain	Known motif – High-throughput in vitro [372]	TAATTR
HOXA10	ENSG00000253293	Homeodomain	Known motif – High-throughput in vitro [373]	TTWAYGAY
HOXA11	ENSG00000005073	Homeodomain	Known motif – High-throughput in vitro [374]	DWTTTACGACB
HOXA13	ENSG00000106031	Homeodomain	Known motif – High-throughput in vitro [375]	DTTTTATKRS
HOXA2	ENSG00000105996	Homeodomain	Known motif – High-throughput in vitro [376]	BTAATKR
HOXA3	ENSG00000105997	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [377]	TAATKR
HOXA4	ENSG00000197576	Homeodomain	Known motif – High-throughput in vitro [378]	TAATKRY
HOXA5	ENSG00000106004	Homeodomain	Known motif – High-throughput in vitro [379]	STAATKRS
HOXA6	ENSG00000106006	Homeodomain	Known motif – High-throughput in vitro [380]	TAATKRV
HOXA7	ENSG00000122592	Homeodomain	Known motif – High-throughput in vitro [381]	TAATKRV
HOXA9	ENSG00000078399	Homeodomain	Known motif – High-throughput in vitro [382]	DTTWAYGAY
HOXB1	ENSG00000120094	Homeodomain	Known motif – High-throughput in vitro [383]	STAATTA
HOXB13	ENSG00000159184	Homeodomain	Known motif – High-throughput in vitro [384]	TTWAYDD
HOXB2	ENSG00000173917	Homeodomain	Known motif – High-throughput in vitro [385]	TAATKR
HOXB3	ENSG00000120093	Homeodomain	Known motif – High-throughput in vitro [386]	BTAATKR
HOXB4	ENSG00000182742	Homeodomain	Known motif – High-throughput in vitro [387]	YTAATKAY
HOXB5	ENSG00000120075	Homeodomain	Known motif – High-throughput in vitro [388]	TAATKRV
HOXB6	ENSG00000108511	Homeodomain	Known motif – High-throughput in vitro [389]	TAATKRY
HOXB7	ENSG00000260027	Homeodomain	Known motif – High-throughput in vitro [390]	BTAATKRV
HOXB8	ENSG00000120068	Homeodomain	Known motif – High-throughput in vitro [391]	TAATKRM
HOXB9	ENSG00000170689	Homeodomain	Known motif – High-throughput in vitro [392]	WTTTAYGAY
HOXC10	ENSG00000180818	Homeodomain	Known motif – High-throughput in vitro [393]	WTTWAYGAB
HOXC11	ENSG00000123388	Homeodomain	Known motif – High-throughput in vitro [394]	WTTWAYGAYH
HOXC12	ENSG00000123407	Homeodomain	Known motif – High-throughput in vitro [395]	DTTTTACGAYY
HOXC13	ENSG00000123364	Homeodomain	Known motif – High-throughput in vitro [396]	CTCGTAAAAH
HOXC4	ENSG00000198353	Homeodomain	Known motif – High-throughput in vitro [397]	TAATKR
HOXC5	ENSG00000172789	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [398]	WRATND
HOXC6	ENSG00000197757	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [399]	TTAATTAB
HOXC8	ENSG00000037965	Homeodomain	Known motif – High-throughput in vitro [400]	YAATTR
HOXC9	ENSG00000180806	Homeodomain	Known motif – High-throughput in vitro [401]	TTTTACGAC
HOXD1	ENSG00000128645	Homeodomain	Known motif – High-throughput in vitro [402]	BTAATTAV
HOXD10	ENSG00000128710	Homeodomain	Known motif – High-throughput in vitro [403]	DTTTTACGACY
HOXD11	ENSG00000128713	Homeodomain	Known motif – High-throughput in vitro [404]	DWTTTACGAY
HOXD12	ENSG00000170178	Homeodomain	Known motif – High-throughput in vitro [405]	DTTTACGAY
HOXD13	ENSG00000128714	Homeodomain	Known motif – High-throughput in vitro [406]	BCTCGTAAAAH
HOXD3	ENSG00000128652	Homeodomain	Known motif – High-throughput in vitro [407]	CTAATTAS
HOXD4	ENSG00000170166	Homeodomain	Known motif – High-throughput in vitro [408]	TMATKRV
HOXD8	ENSG00000175879	Homeodomain	Known motif – High-throughput in vitro [409]	HWMATTWDB
HOXD9	ENSG00000128709	Homeodomain	Known motif – High-throughput in vitro [410]	TTTTATKRC
HSF1	ENSG00000185122	HSF	Known motif – High-throughput in vitro [411]	VGAABVTTCBVGAW
HSF2	ENSG00000025156	HSF	Known motif – High-throughput in vitro [412]	VGAANNTTCBVGAA
HSF4	ENSG00000102878	HSF	Known motif – High-throughput in vitro [413]	GAANNTTCBVGAA
HSF5	ENSG00000176160	HSF	Known motif – High-throughput in vitro [414]	RCGTTCTAGAAYGY
HSFX1	ENSG00000171116	HSF	Likely sequence specific TF according to literature or domain structure – No motif [415]
HSFX2	ENSG00000268738	HSF	Likely sequence specific TF according to literature or domain structure – No motif [416]
HSFY1	ENSG00000172468	HSF	Known motif – High-throughput in vitro [417]	DTVGAAYGWTTCGAAYGB
HSFY2	ENSG00000169953	HSF	Known motif – High-throughput in vitro [418]	DTCGAAHSNWTCGAW
IKZF1	ENSG00000185811	C2H2 ZF	Known motif – In vivo/Misc source [419]	BTGGGARD
IKZF2	ENSG00000030419	C2H2 ZF	Known motif – In vivo/Misc source [420]	HDWHGGGADD
IKZF3	ENSG00000161405	C2H2 ZF	Known motif – High-throughput in vitro [421]	VSNNGGGAA
IKZF4	ENSG00000123411	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [422]	HDWHGGGADD
IKZF5	ENSG00000095574	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [423]	MYYATGCAGRGT
INSM1	ENSG00000173404	C2H2 ZF	Known motif – In vivo/Misc source [424]	YRMCCCCWKRCA
INSM2	ENSG00000168348	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [425]
IRF1	ENSG00000125347	IRF	Known motif – In vivo/Misc source [426]	GAAASTGAAASY
IRF2	ENSG00000168310	IRF	Known motif – High-throughput in vitro [427]	GAAAVYGAAAS
IRF3	ENSG00000126456	IRF	Known motif – High-throughput in vitro [428]	HSGAAAVBGAAACYGAAAC
IRF4	ENSG00000137265	IRF	Known motif – High-throughput in vitro [429]	HCGAAACCGAAACYW
IRF5	ENSG00000128604	IRF	Known motif – High-throughput in vitro [430]	CGAAACCGAWACH
IRF6	ENSG00000117595	IRF	Known motif – High-throughput in vitro [431]	RGTWTCRNNNNNNCGAWACY
IRF7	ENSG00000185507	IRF	Known motif – High-throughput in vitro [432]	CGAAAVYGAAANY
IRF8	ENSG00000140968	IRF	Known motif – High-throughput in vitro [433]	CGAAACYGAAACY
IRF9	ENSG00000213928	IRF	Known motif – High-throughput in vitro [434]	AWCGAAACCGAAACY
IRX1	ENSG00000170549	Homeodomain	Known motif – High-throughput in vitro [435]	DDCRHNNNNNNNNDYGHH
IRX2	ENSG00000170561	Homeodomain	Known motif – High-throughput in vitro [436]	DTGTYRTGTH
IRX3	ENSG00000177508	Homeodomain	Known motif – High-throughput in vitro [437]	DACAHGNWWWWNCDTGTH
IRX4	ENSG00000113430	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [438]	DAMAH
IRX5	ENSG00000176842	Homeodomain	Known motif – High-throughput in vitro [439]	DTGTYRTGTH
IRX6	ENSG00000159387	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [440]	DAMAH
ISL1	ENSG00000016082	Homeodomain	Known motif – High-throughput in vitro [441]	BTAAKTGS
ISL2	ENSG00000159556	Homeodomain	Known motif – High-throughput in vitro [442]	YTAAKTGB
ISX	ENSG00000175329	Homeodomain	Known motif – High-throughput in vitro [443]	CYAATTAV
JAZF1	ENSG00000153814	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [444]
JDP2	ENSG00000140044	bZIP	Known motif – High-throughput in vitro [445]	RTKACRTMAY
JRK	ENSG00000234616	CENPB	Likely sequence specific TF according to literature or domain structure – No motif [446]
JRKL	ENSG00000183340	CENPB	Inferred motif from similar protein – High-throughput in vitro [447]	RCGGWWR
JUN	ENSG00000177606	bZIP	Known motif – High-throughput in vitro [448]	DATGACGTMAHNV
JUNB	ENSG00000171223	bZIP	Known motif – High-throughput in vitro [449]	RTKACGTMAY
JUND	ENSG00000130522	bZIP	Known motif – High-throughput in vitro [450]	VTGACGTMA
KAT7	ENSG00000136504	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [451]
KCMF1	ENSG00000176407	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [452]
KCNIP3	ENSG00000115041	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [453]
KDM2A	ENSG00000173120	CxxC	Likely sequence specific TF according to literature or domain structure – No motif [454]
KDM2B	ENSG00000089094	CxxC	Known motif – High-throughput in vitro [455]	CG
KDM5B	ENSG00000117139	ARID/BRIGHT	Likely sequence specific TF according to literature or domain structure – No motif [456]
KIN	ENSG00000151657	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [457]
KLF1	ENSG00000105610	C2H2 ZF	Known motif – High-throughput in vitro [458]	CMCGCCCM
KLF10	ENSG00000155090	C2H2 ZF	Known motif – High-throughput in vitro [459]	RMCACRCCCMYVHCACRCCCMC
KLF11	ENSG00000172059	C2H2 ZF	Known motif – High-throughput in vitro [460]	VMCMCRCCCMYNMCACGCCCMC
KLF12	ENSG00000118922	C2H2 ZF	Known motif – High-throughput in vitro [461]	DRCCACGCCCH
KLF13	ENSG00000169926	C2H2 ZF	Known motif – High-throughput in vitro [462]	RCCACRCCCMC
KLF14	ENSG00000266265	C2H2 ZF	Known motif – High-throughput in vitro [463]	DRHCACGCCCMYYH
KLF15	ENSG00000163884	C2H2 ZF	Known motif – High-throughput in vitro [464]	VHCMCVCCCMY
KLF16	ENSG00000129911	C2H2 ZF	Known motif – High-throughput in vitro [465]	VMCMCDCCCMC
KLF17	ENSG00000171872	C2H2 ZF	Known motif – High-throughput in vitro [466]	MMCCACVCWCCCMTY
KLF2	ENSG00000127528	C2H2 ZF	Known motif – High-throughput in vitro [467]	VCCMCRCCCH
KLF3	ENSG00000109787	C2H2 ZF	Known motif – High-throughput in vitro [468]	RRCCRCGCCCH
KLF4	ENSG00000136826	C2H2 ZF	Known motif – High-throughput in vitro [469]	VCCACRCCCH
KLF5	ENSG00000102554	C2H2 ZF	Known motif – High-throughput in vitro [470]	MCACRCCCH
KLF6	ENSG00000067082	C2H2 ZF	Known motif – High-throughput in vitro [471]	VMCACRCCCH
KLF7	ENSG00000118263	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [472]	HHMCRCCCH
KLF8	ENSG00000102349	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [473]	MCRCCY
KLF9	ENSG00000119138	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [474]	TAACGG
KMT2A	ENSG00000118058	CxxC; AT hook	Known motif – High-throughput in vitro [475]	HNCGNB
KMT2B	ENSG00000272333	CxxC; AT hook	Likely sequence specific TF according to literature or domain structure – No motif [476]
L3MBTL1	ENSG00000185513	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [477]
L3MBTL3	ENSG00000198945	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [478]
L3MBTL4	ENSG00000154655	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [479]
LBX1	ENSG00000138136	Homeodomain	Known motif – High-throughput in vitro [480]	TAAYTRG
LBX2	ENSG00000179528	Homeodomain	Known motif – High-throughput in vitro [481]	TAATTRV
LCOR	ENSG00000196233	Pipsqueak	Known motif – from protein with 100% identical DBD – in vitro [482]	YNAAW
LCORL	ENSG00000178177	Pipsqueak	Known motif – High-throughput in vitro [483]	HYNAAWH
LEF1	ENSG00000138795	HMG/Sox	Known motif – High-throughput in vitro [484]	SATCAAAS
LEUTX	ENSG00000213921	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [485]
LHX1	ENSG00000273706	Homeodomain	Known motif – High-throughput in vitro [486]	TRATBR
LHX2	ENSG00000106689	Homeodomain	Known motif – High-throughput in vitro [487]	HHDTTR
LHX3	ENSG00000107187	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [488]	YAATHW
LHX4	ENSG00000121454	Homeodomain	Known motif – High-throughput in vitro [489]	BYRATTRV
LHX5	ENSG00000089116	Homeodomain	Known motif – High-throughput in vitro [490]	TAATTRS
LHX6	ENSG00000106852	Homeodomain	Known motif – High-throughput in vitro [491]	TRATTR
LHX8	ENSG00000162624	Homeodomain	Known motif – High-throughput in vitro [492]	STAATTA
LHX9	ENSG00000143355	Homeodomain	Known motif – High-throughput in vitro [493]	TAATTRG
LIN28A	ENSG00000131914	CSD	Inferred motif from similar protein – High-throughput in vitro [494]	CGCHGYYHYWYCGCG
LIN28B	ENSG00000187772	CSD	Known motif – High-throughput in vitro [495]	CGCHGYYHYWYCGCG
LIN54	ENSG00000189308	TCR/CxC	Inferred motif from similar protein – High-throughput in vitro [496]	RTTYAAAH
LMX1A	ENSG00000162761	Homeodomain	Known motif – High-throughput in vitro [497]	BTAATTA
LMX1B	ENSG00000136944	Homeodomain	Known motif – High-throughput in vitro [498]	TWATTR
LTF	ENSG00000012223	Unknown	Known motif – In vivo/Misc source [499]	GKVACTKB
LYL1	ENSG00000104903	bHLH	Inferred motif from similar protein – In vivo/Misc source [500]	RNCAGVTGGH
MAF	ENSG00000178573	bZIP	Known motif – High-throughput in vitro [501]	TGCTGACDHDRCR
MAFA	ENSG00000182759	bZIP	Known motif – High-throughput in vitro [502]	WWWNTGCTGACD
MAFB	ENSG00000204103	bZIP	Known motif – from protein with 100% identical DBD – in vitro [503]	TGCTGAC
MAFF	ENSG00000185022	bZIP	Known motif – High-throughput in vitro [504]	YGCTGASTCAGCR
MAFG	ENSG00000197063	bZIP	Known motif – High-throughput in vitro [505]	YGCTGABNDNGCR
MAFK	ENSG00000198517	bZIP	Known motif – High-throughput in vitro [506]	DNNYGCTKAVTCAGCRNNH
MAX	ENSG00000125952	bHLH	Known motif – High-throughput in vitro [507]	CACGTG
MAZ	ENSG00000103495	C2H2 ZF	Known motif – High-throughput in vitro [508]	GGGMGGGGS
MBD1	ENSG00000141644	MBD; CxxC ZF	Likely sequence specific TF according to literature or domain structure – No motif [509]
MBD2	ENSG00000134046	MBD	Known motif – In vivo/Misc source [510]	VSGKCCGGMKR
MBD3	ENSG00000071655	MBD	Likely sequence specific TF according to literature or domain structure – No motif [511]
MBD4	ENSG00000129071	MBD	Likely sequence specific TF according to literature or domain structure – No motif [512]
MBD6	ENSG00000166987	MBD	Likely sequence specific TF according to literature or domain structure – No motif [513]
MBNL2	ENSG00000139793	CCCH ZF	Likely sequence specific TF according to literature or domain structure – High-throughput in vitro [514]	YGCYTYGCYTH
MECOM	ENSG00000085276	C2H2 ZF	Known motif – In vivo/Misc source [515]	WGAYAAGATAANAND
MECP2	ENSG00000169057	MBD; AT hook	Known motif – from protein with 100% identical DBD – in vitro [516]	DTD
MEF2A	ENSG00000068305	MADS box	Known motif – High-throughput in vitro [517]	KCTAWAAATAGM
MEF2B	ENSG00000213999	MADS box	Known motif – High-throughput in vitro [518]	TGTTACCATAWHBGG
MEF2C	ENSG00000081189	MADS box	Known motif – High-throughput in vitro [519]	TWCTAWAAATAG
MEF2D	ENSG00000116604	MADS box	Known motif – High-throughput in vitro [520]	DCTAWAAATAGM
MEIS1	ENSG00000143995	Homeodomain	Known motif – High-throughput in vitro [521]	TGACA
MEIS2	ENSG00000134138	Homeodomain	Known motif – High-throughput in vitro [522]	TGACASSTGTC
MEIS3	ENSG00000105419	Homeodomain	Known motif – High-throughput in vitro [523]	TGACAGSTGTCA
MEOX1	ENSG00000005102	Homeodomain	Known motif – High-throughput in vitro [524]	STAATTA
MEOX2	ENSG00000106511	Homeodomain	Known motif – High-throughput in vitro [525]	STMATYA
MESP1	ENSG00000166823	bHLH	Known motif – High-throughput in vitro [526]	HVCACCTGB
MESP2	ENSG00000188095	bHLH	Known motif – High-throughput in vitro [527]	AMCATATGKYR
MGA	ENSG00000174197	T-box	Known motif – High-throughput in vitro [528]	AGGTGTKAHDTMACACCT
MITF	ENSG00000187098	bHLH	Known motif – from protein with 100% identical DBD – in vitro [529]	RTCACGHG
MIXL1	ENSG00000185155	Homeodomain	Known motif – High-throughput in vitro [530]	TAATTR
MKX	ENSG00000150051	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [531]
MLX	ENSG00000108788	bHLH	Known motif – High-throughput in vitro [532]	VCACGTGVY
MLXIP	ENSG00000175727	bHLH	Inferred motif from similar protein – High-throughput in vitro [533]	HCACGTGV
MLXIPL	ENSG00000009950	bHLH	Known motif – High-throughput in vitro [534]	DDCACGTGNH
MNT	ENSG00000070444	bHLH	Known motif – High-throughput in vitro [535]	DNCACGTGB
MNX1	ENSG00000130675	Homeodomain	Known motif – High-throughput in vitro [536]	HTAATTRNH
MSANTD1	ENSG00000188981	MADF	Likely sequence specific TF according to literature or domain structure – No motif [537]
MSANTD3	ENSG00000066697	MADF	Known motif – High-throughput in vitro [538]	SBNCACTCAM
MSANTD4	ENSG00000170903	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [539]
MSC	ENSG00000178860	bHLH	Known motif – High-throughput in vitro [540]	RMCAGCTGBYV
MSGN1	ENSG00000151379	bHLH	Known motif – High-throughput in vitro [541]	VMCAWWTGGY
MSX1	ENSG00000163132	Homeodomain	Known motif – High-throughput in vitro [542]	TAATTR
MSX2	ENSG00000120149	Homeodomain	Known motif – High-throughput in vitro [543]	TAATTGB
MTERF1	ENSG00000127989	mTERF	Known motif – In vivo/Misc source [544]	TGGTAVWRKTYGGT
MTERF2	ENSG00000120832	mTERF	Likely sequence specific TF according to literature or domain structure – No motif [545]
MTERF3	ENSG00000156469	mTERF	Likely sequence specific TF according to literature or domain structure – No motif [546]
MTERF4	ENSG00000122085	mTERF	Likely sequence specific TF according to literature or domain structure – No motif [547]
MTF1	ENSG00000188786	C2H2 ZF	Known motif – High-throughput in vitro [548]	TTTGCACACGGCAC
MTF2	ENSG00000143033	Unknown	Known motif – High-throughput in vitro [549]
MXD1	ENSG00000059728	bHLH	Inferred motif from similar protein – In vivo/Misc source [550]	CACGTGAY
MXD3	ENSG00000213347	bHLH	Inferred motif from similar protein – In vivo/Misc source [551]	CACGTGAY
MXD4	ENSG00000123933	bHLH	Inferred motif from similar protein – In vivo/Misc source [552]	CACGTGAY
MXI1	ENSG00000119950	bHLH	Known motif – In vivo/Misc source [553]	CCACGTGG
MYB	ENSG00000118513	Myb/SANT	Known motif – In vivo/Misc source [554]	BAACKGNH
MYBL1	ENSG00000185697	Myb/SANT	Known motif – High-throughput in vitro [555]	HRACCGTTW
MYBL2	ENSG00000101057	Myb/SANT	Known motif – High-throughput in vitro [556]	WAACGGTY
MYC	ENSG00000136997	bHLH	Known motif – In vivo/Misc source [557]	RCCACGTGSB
MYCL	ENSG00000116990	bHLH	Inferred motif from similar protein – In vivo/Misc source [558]	RCCACGTG
MYCN	ENSG00000134323	bHLH	Known motif – High-throughput in vitro [559]	VCACGTG
MYF5	ENSG00000111049	bHLH	Known motif – In vivo/Misc source [560]	VCWSCASSTGYCW
MYF6	ENSG00000111046	bHLH	Known motif – High-throughput in vitro [561]	RACASSTGWYV
MYNN	ENSG00000085274	C2H2 ZF	Known motif – High-throughput in vitro [562]	AAAWTAARAGYC
MYOD1	ENSG00000129152	bHLH	Known motif – High-throughput in vitro [563]	YGHCAGSTGKYV
MYOG	ENSG00000122180	bHLH	Known motif – High-throughput in vitro [564]	RACARCTGWCR
MYPOP	ENSG00000176182	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [565]
MYRF	ENSG00000124920	Ndt80/PhoG	Known motif – High-throughput in vitro [566]	TGGTACCA
MYRFL	ENSG00000166268	Ndt80/PhoG	Likely sequence specific TF according to literature or domain structure – No motif [567]
MYSM1	ENSG00000162601	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [568]
MYT1	ENSG00000196132	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [569]
MYT1L	ENSG00000186487	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [570]	VAAGTTT
MZF1	ENSG00000099326	C2H2 ZF	Known motif – In vivo/Misc source [571]	DRDGGGGAD
NACC2	ENSG00000148411	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [572]
NAIF1	ENSG00000171169	MADF	Inferred motif from similar protein – High-throughput in vitro [573]	TACGYH
NANOG	ENSG00000111704	Homeodomain	Known motif – High-throughput in vitro [574]	YRABBVB
NANOGNB	ENSG00000205857	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [575]
NANOGP8	ENSG00000255192	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [576]	YRABBVB
NCOA1	ENSG00000084676	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [577]
NCOA2	ENSG00000140396	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [578]
NCOA3	ENSG00000124151	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [579]
NEUROD1	ENSG00000162992	bHLH	Known motif – High-throughput in vitro [580]	AAWTANNNBRMCATATGKY
NEUROD2	ENSG00000171532	bHLH	Known motif – High-throughput in vitro [581]	RMCATATGBY
NEUROD4	ENSG00000123307	bHLH	Inferred motif from similar protein – High-throughput in vitro [582]	AAWTANNNBRMCATATGKY
NEUROD6	ENSG00000164600	bHLH	Inferred motif from similar protein – High-throughput in vitro [583]	AAWTANNNBRMCATATGKY
NEUROG1	ENSG00000181965	bHLH	Known motif – High-throughput in vitro [584]	RVCATATGBY
NEUROG2	ENSG00000178403	bHLH	Known motif – High-throughput in vitro [585]	RVCATATGBY
NEUROG3	ENSG00000122859	bHLH	Inferred motif from similar protein – High-throughput in vitro [586]	RVCATATGBY
NFAT5	ENSG00000102908	Rel	Known motif – High-throughput in vitro [587]	RTGGAAAWKTACH
NFATC1	ENSG00000131196	Rel	Known motif – High-throughput in vitro [588]	RTGGAAAHW
NFATC2	ENSG00000101096	Rel	Known motif – High-throughput in vitro [589]	DYGGAAANW
NFATC3	ENSG00000072736	Rel	Known motif – High-throughput in vitro [590]	YGGAAANH
NFATC4	ENSG00000100968	Rel	Known motif – High-throughput in vitro [591]	YRBWWW
NFE2	ENSG00000123405	bZIP	Known motif – High-throughput in vitro [592]	VATGACTCATB
NFE2L1	ENSG00000082641	bZIP	Known motif – In vivo/Misc source [593]	ATGAYD
NFE2L2	ENSG00000116044	bZIP	Known motif – In vivo/Misc source [594]	VVTGACTMAGCA
NFE2L3	ENSG00000050344	bZIP	Known motif – In vivo/Misc source [595]	TATTWSCAAGGA
NFE4	ENSG00000230257	Unknown	Known motif – In vivo/Misc source [596]	VHCCCKMKCCWS
NFIA	ENSG00000162599	SMAD	Known motif – High-throughput in vitro [597]	YTGGCANNNTGCCAA
NFIB	ENSG00000147862	SMAD	Known motif – High-throughput in vitro [598]	TTGGCANNNTGCCAR
NFIC	ENSG00000141905	SMAD	Known motif – High-throughput in vitro [599]	YTGGCANNNNGCCAA
NFIL3	ENSG00000165030	bZIP	Known motif – High-throughput in vitro [600]	VTTACRTAAY
NFIX	ENSG00000008441	SMAD	Known motif – High-throughput in vitro [601]	TTGGCANNNTGCCAR
NFKB1	ENSG00000109320	Rel	Known motif – High-throughput in vitro [602]	AGGGGAWTCCCCK
NFKB2	ENSG00000077150	Rel	Known motif – High-throughput in vitro [603]	VGGGGAWTCCCC
NFX1	ENSG00000086102	NFX	Likely sequence specific TF according to literature or domain structure – No motif [604]
NFXL1	ENSG00000170448	NFX	Likely sequence specific TF according to literature or domain structure – No motif [605]
NFYA	ENSG00000001167	CBF/NF-Y	Known motif – In vivo/Misc source [606]	HBSYSATTGGYYV
NFYB	ENSG00000120837	Unknown	Known motif – In vivo/Misc source [607]	CTSATTGGYYVVNNB
NFYC	ENSG00000066136	Unknown	Known motif – In vivo/Misc source [608]	BSTSATTGGYYR
NHLH1	ENSG00000171786	bHLH	Known motif – High-throughput in vitro [609]	DKGRCGCAGCTGMKNCH
NHLH2	ENSG00000177551	bHLH	Known motif – High-throughput in vitro [610]	DDGNMGCAGCTGCGYCMH
NKRF	ENSG00000186416	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [611]
NKX1-1	ENSG00000235608	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [612]	TAATND
NKX1-2	ENSG00000229544	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [613]	TAAWND
NKX2-1	ENSG00000136352	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [614]	RAGDR
NKX2-2	ENSG00000125820	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [615]	RAGDR
NKX2-3	ENSG00000119919	Homeodomain	Known motif – High-throughput in vitro [616]	VCACTTV
NKX2-4	ENSG00000125816	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [617]	RAGDR
NKX2-5	ENSG00000183072	Homeodomain	Known motif – High-throughput in vitro [618]	VCACTTRDV
NKX2-6	ENSG00000180053	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [619]	HYAAGTRB
NKX2-8	ENSG00000136327	Homeodomain	Known motif – High-throughput in vitro [620]	BTSRAGTGB
NKX3-1	ENSG00000167034	Homeodomain	Known motif – High-throughput in vitro [621]	TAAGTGS
NKX3-2	ENSG00000109705	Homeodomain	Known motif – High-throughput in vitro [622]	TAAGTGS
NKX6-1	ENSG00000163623	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [623]	DTDATNR
NKX6-2	ENSG00000148826	Homeodomain	Known motif – High-throughput in vitro [624]	DTAATTR
NKX6-3	ENSG00000165066	Homeodomain	Known motif – High-throughput in vitro [625]	WTAATGRB
NME2	ENSG00000243678	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [626]
NOBOX	ENSG00000106410	Homeodomain	Known motif – High-throughput in vitro [627]	HDATDR
NOTO	ENSG00000214513	Homeodomain	Known motif – High-throughput in vitro [628]	YWMATTA
NPAS1	ENSG00000130751	bHLH	Inferred motif from similar protein – In vivo/Misc source [629]	VVNGCACGTMBNS
NPAS2	ENSG00000170485	bHLH	Known motif – High-throughput in vitro [630]	DMCACGTGY
NPAS3	ENSG00000151322	bHLH	Inferred motif from similar protein – In vivo/Misc source [631]	VVNGCACGTMBNS
NPAS4	ENSG00000174576	bHLH	Inferred motif from similar protein – High-throughput in vitro [632]
NR0B1	ENSG00000169297	Unknown	Known motif – In vivo/Misc source [633]	YBTYCCMCKS
NR1D1	ENSG00000126368	Nuclear receptor	Known motif – High-throughput in vitro [634]	TGACCYASTRACCYANWW
NR1D2	ENSG00000174738	Nuclear receptor	Known motif – High-throughput in vitro [635]	YRACMYANTRACMYMNWWH
NR1H2	ENSG00000131408	Nuclear receptor	Known motif – In vivo/Misc source [636]	TAAAGGTCAAAGGTCAASK
NR1H3	ENSG00000025434	Nuclear receptor	Inferred motif from similar protein – In vivo/Misc source [637]	TAAAGGTCAAAGGTCAASK
NR1H4	ENSG00000012504	Nuclear receptor	Known motif – High-throughput in vitro [638]	RGKTCRTTGACCYBNNRGGTBADRGKKBNDRGKTCAHHKD
NR1I2	ENSG00000144852	Nuclear receptor	Known motif – High-throughput in vitro [639]	YGMMCYBNNYGMMCY
NR1I3	ENSG00000143257	Nuclear receptor	Known motif – High-throughput in vitro [640]	RGKDYRNNNNRGKKYR
NR2C1	ENSG00000120798	Nuclear receptor	Known motif – High-throughput in vitro [641]	RGKKCRYGAMMY
NR2C2	ENSG00000177463	Nuclear receptor	Known motif – High-throughput in vitro [642]	VRGGTCAAAGGTCA
NR2E1	ENSG00000112333	Nuclear receptor	Known motif – High-throughput in vitro [643]	AAGTCA
NR2E3	ENSG00000278570	Nuclear receptor	Known motif – High-throughput in vitro [644]	RAGATCAM
NR2F1	ENSG00000175745	Nuclear receptor	Known motif – High-throughput in vitro [645]	RRGGTCAAAGGTCA
NR2F2	ENSG00000185551	Nuclear receptor	Known motif – from protein with 100% identical DBD – in vitro [646]	RRGGTCA
NR2F6	ENSG00000160113	Nuclear receptor	Known motif – High-throughput in vitro [647]	RGGTCAAAGGTCA
NR3C1	ENSG00000113580	Nuclear receptor	Known motif – High-throughput in vitro [648]	RGWACAYNRTGTWCYH
NR3C2	ENSG00000151623	Nuclear receptor	Known motif – High-throughput in vitro [649]	RGDACAHDRTGTHCY
NR4A1	ENSG00000123358	Nuclear receptor	Known motif – High-throughput in vitro [650]	AAAGGTCA
NR4A2	ENSG00000153234	Nuclear receptor	Known motif – High-throughput in vitro [651]	BTAAAGGTCA
NR4A3	ENSG00000119508	Nuclear receptor	Known motif – In vivo/Misc source [652]	CAAAGGTCAS
NR5A1	ENSG00000136931	Nuclear receptor	Known motif – High-throughput in vitro [653]	CAAGGYCR
NR5A2	ENSG00000116833	Nuclear receptor	Known motif – High-throughput in vitro [654]	YCAAGGTCAH
NR6A1	ENSG00000148200	Nuclear receptor	Known motif – High-throughput in vitro [655]	SAAGKTCAAGKKYR
NRF1	ENSG00000106459	Unknown	Known motif – High-throughput in vitro [656]	YRCGCATGCGC
NRL	ENSG00000129535	bZIP	Known motif – High-throughput in vitro [657]	DWHNYGCTGAC
OLIG1	ENSG00000184221	bHLH	Known motif – High-throughput in vitro [658]	AVCATATGKT
OLIG2	ENSG00000205927	bHLH	Known motif – High-throughput in vitro [659]	AMCATATGKY
OLIG3	ENSG00000177468	bHLH	Known motif – High-throughput in vitro [660]	RSCATATGKY
ONECUT1	ENSG00000169856	CUT; Homeodomain	Known motif – High-throughput in vitro [661]	DDTATCGATYD
ONECUT2	ENSG00000119547	CUT; Homeodomain	Known motif – High-throughput in vitro [662]	DTATCGATCS
ONECUT3	ENSG00000205922	CUT; Homeodomain	Known motif – High-throughput in vitro [663]	DWTATYGATTTTY
OSR1	ENSG00000143867	C2H2 ZF	Known motif – High-throughput in vitro [664]	HACRGTAGC
OSR2	ENSG00000164920	C2H2 ZF	Known motif – High-throughput in vitro [665]	HVCRGTAGC
OTP	ENSG00000171540	Homeodomain	Known motif – from protein with 100% identical DBD – in vitro [666]	HAATND
OTX1	ENSG00000115507	Homeodomain	Known motif – High-throughput in vitro [667]	TAATCSB
OTX2	ENSG00000165588	Homeodomain	Known motif – High-throughput in vitro [668]	HTAATCCB
OVOL1	ENSG00000172818	C2H2 ZF	Known motif – High-throughput in vitro [669]	RNRTAACGGTHH
OVOL2	ENSG00000125850	C2H2 ZF	Known motif – High-throughput in vitro [670]	DNNTARCGGD
OVOL3	ENSG00000105261	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [671]
PA2G4	ENSG00000170515	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [672]
PATZ1	ENSG00000100105	C2H2 ZF; AT hook	Known motif – In vivo/Misc source [673]	GGGHGGGG
PAX1	ENSG00000125813	Paired box	Known motif – High-throughput in vitro [674]	SGTCACGCWTSANTGVH
PAX2	ENSG00000075891	Homeodomain; Paired box	Known motif – High-throughput in vitro [675]	SGTCACGCWTSRNTGVNY
PAX3	ENSG00000135903	Homeodomain; Paired box	Known motif – High-throughput in vitro [676]	TAATCRATTA
PAX4	ENSG00000106331	Homeodomain; Paired box	Known motif – High-throughput in vitro [677]	HKAATTAR
PAX5	ENSG00000196092	Paired box	Known motif – High-throughput in vitro [678]	GTYACGSWTSRNTRVNY
PAX6	ENSG00000007372	Homeodomain; Paired box	Known motif – High-throughput in vitro [679]	YACGCHYSRNYRMNY
PAX7	ENSG00000009709	Homeodomain; Paired box	Known motif – High-throughput in vitro [680]	TAATYRATTW
PAX8	ENSG00000125618	Paired box	Known motif – High-throughput in vitro [681]	RNBYRNYSRWGCGTGACS
PAX9	ENSG00000198807	Paired box	Known motif – High-throughput in vitro [682]	SGTCACGCWTSANTGM
PBX1	ENSG00000185630	Homeodomain	Known motif – High-throughput in vitro [683]	TGATKGAYR
PBX2	ENSG00000204304	Homeodomain	Known motif – In vivo/Misc source [684]	KRVHKTGATTGAWK
PBX3	ENSG00000167081	Homeodomain	Known motif – In vivo/Misc source [685]	BBBTGATTGRYND
PBX4	ENSG00000105717	Homeodomain	Known motif – High-throughput in vitro [686]	HDWHH
PCGF2	ENSG00000277258	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [687]
PCGF6	ENSG00000156374	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [688]
PDX1	ENSG00000139515	Homeodomain	Known motif – High-throughput in vitro [689]	BTAATKR
PEG3	ENSG00000198300	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [690]
PGR	ENSG00000082175	Nuclear receptor	Known motif – High-throughput in vitro [691]	RGNACRNNNTGTNCH
PHF1	ENSG00000112511	Unknown	Known motif – High-throughput in vitro [692]
PHF19	ENSG00000119403	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [693]
PHF20	ENSG00000025293	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [694]
PHF21A	ENSG00000135365	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [695]
PHOX2A	ENSG00000165462	Homeodomain	Known motif – High-throughput in vitro [696]	TAATTRVRTTA
PHOX2B	ENSG00000109132	Homeodomain	Known motif – High-throughput in vitro [697]	TAATTRVRTTA
PIN1	ENSG00000127445	MBD	Likely sequence specific TF according to literature or domain structure – No motif [698]
PITX1	ENSG00000069011	Homeodomain	Known motif – High-throughput in vitro [699]	HTAATCC
PITX2	ENSG00000164093	Homeodomain	Known motif – High-throughput in vitro [700]	TAAKCC
PITX3	ENSG00000107859	Homeodomain	Known motif – High-throughput in vitro [701]	HTAATCC
PKNOX1	ENSG00000160199	Homeodomain	Known motif – High-throughput in vitro [702]	TGACAGCTGTCA
PKNOX2	ENSG00000165495	Homeodomain	Known motif – High-throughput in vitro [703]	TGACAGSTGTCA
PLAG1	ENSG00000181690	C2H2 ZF	Known motif – High-throughput in vitro [704]	GGGGCCHWMGGGGG
PLAGL1	ENSG00000118495	C2H2 ZF	Known motif – In vivo/Misc source [705]	RGGCCCCCYB
PLAGL2	ENSG00000126003	C2H2 ZF	Known motif – High-throughput in vitro [706]	RGGGGCCC
PLSCR1	ENSG00000188313	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [707]
POGK	ENSG00000143157	Brinker	Likely sequence specific TF according to literature or domain structure – No motif [708]
POU1F1	ENSG00000064835	Homeodomain; POU	Known motif – High-throughput in vitro [709]	DWTATGCWAATKAD
POU2AF1	ENSG00000110777	Unknown	Known motif – In vivo/Misc source [710]	GATKTGCAKAT
POU2F1	ENSG00000143190	Homeodomain; POU	Known motif – High-throughput in vitro [711]	WTGMATATKYADD
POU2F2	ENSG00000028277	Homeodomain; POU	Known motif – High-throughput in vitro [712]	DTGMATATKYADD
POU2F3	ENSG00000137709	Homeodomain; POU	Known motif – High-throughput in vitro [713]	TATGYWAAT
POU3F1	ENSG00000185668	Homeodomain; POU	Known motif – High-throughput in vitro [714]	WTATGYWAATD
POU3F2	ENSG00000184486	Homeodomain; POU	Known motif – High-throughput in vitro [715]	WTATGYWAATKW
POU3F3	ENSG00000198914	Homeodomain; POU	Known motif – High-throughput in vitro [716]	WWDMWTAWKHAW
POU3F4	ENSG00000196767	Homeodomain; POU	Known motif – High-throughput in vitro [717]	WDAWTTATKCA
POU4F1	ENSG00000152192	Homeodomain; POU	Known motif – High-throughput in vitro [718]	TDMATWATKYA
POU4F2	ENSG00000151615	Homeodomain; POU	Known motif – High-throughput in vitro [719]	BTMATTAAWTATKCA
POU4F3	ENSG00000091010	Homeodomain; POU	Known motif – High-throughput in vitro [720]	RTNMATWATKYAT
POU5F1	ENSG00000204531	Homeodomain; POU	Known motif – High-throughput in vitro [721]	WTATGYWAATKWVB
POU5F1B	ENSG00000212993	Homeodomain; POU	Known motif – High-throughput in vitro [722]	TATGYWAAT
POU5F2	ENSG00000248483	Homeodomain; POU	Likely sequence specific TF according to literature or domain structure – No motif [723]
POU6F1	ENSG00000184271	Homeodomain; POU	Known motif – High-throughput in vitro [724]	MTCATTAH
POU6F2	ENSG00000106536	Homeodomain; POU	Known motif – High-throughput in vitro [725]	DTAATKAGBH
PPARA	ENSG00000186951	Nuclear receptor	Known motif – In vivo/Misc source [726]	DAGGTCA
PPARD	ENSG00000112033	Nuclear receptor	Known motif – High-throughput in vitro [727]	RRGGTCAAAGGTCA
PPARG	ENSG00000132170	Nuclear receptor	Known motif – from protein with 100% identical DBD – in vitro [728]	VNTRMCCYANWDNRACCTWTNVCCYVNW
PRDM1	ENSG00000057657	C2H2 ZF	Known motif – High-throughput in vitro [729]	RAAAGTGAAAGTD
PRDM10	ENSG00000170325	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [730]
PRDM12	ENSG00000130711	C2H2 ZF	Known motif – In vivo/Misc source [731]	GACAGNTKACC
PRDM13	ENSG00000112238	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [732]
PRDM14	ENSG00000147596	C2H2 ZF	Known motif – In vivo/Misc source [733]	RSTTAGRGACCY
PRDM15	ENSG00000141956	C2H2 ZF	Known motif – In vivo/Misc source [734]	DTGGAAHTCCMA
PRDM16	ENSG00000142611	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [735]	DAGAYAAGATAANM
PRDM2	ENSG00000116731	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [736]
PRDM4	ENSG00000110851	C2H2 ZF	Known motif – High-throughput in vitro [737]	TTTCAAGGCCCCC
PRDM5	ENSG00000138738	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [738]
PRDM6	ENSG00000061455	C2H2 ZF	Known motif – In vivo/Misc source [739]	RVARDRRAAADDVWRRAAAA
PRDM8	ENSG00000152784	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [740]
PRDM9	ENSG00000164256	C2H2 ZF	Known motif – High-throughput in vitro [741]	VGNGGBNRSGGDGGNNNNARVRRV
PREB	ENSG00000138073	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [742]
PRMT3	ENSG00000185238	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [743]
PROP1	ENSG00000175325	Homeodomain	Known motif – High-throughput in vitro [744]	TAAYYNMATTA
PROX1	ENSG00000117707	Prospero	Known motif – High-throughput in vitro [745]	BAAGACGYCTTV
PROX2	ENSG00000119608	Prospero	Inferred motif from similar protein – High-throughput in vitro [746]	BAMGRCGTCDTV
PRR12	ENSG00000126464	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [747]
PRRX1	ENSG00000116132	Homeodomain	Known motif – High-throughput in vitro [748]	TAATTR
PRRX2	ENSG00000167157	Homeodomain	Known motif – High-throughput in vitro [749]	TAATTRV
PTF1A	ENSG00000168267	bHLH	Known motif – High-throughput in vitro [750]	VYGTCAGCTGTT
PURA	ENSG00000185129	Unknown	Known motif – In vivo/Misc source [751]	CYMBGSCHNCMMMBWCC
PURB	ENSG00000146676	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [752]
PURG	ENSG00000172733	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [753]
RAG1	ENSG00000166349	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [754]
RARA	ENSG00000131759	Nuclear receptor	Known motif – High-throughput in vitro [755]	RRGGTCANV
RARB	ENSG00000077092	Nuclear receptor	Known motif – High-throughput in vitro [756]	TGACCYYTTGACCYY
RARG	ENSG00000172819	Nuclear receptor	Known motif – High-throughput in vitro [757]	VGGTCA
RAX	ENSG00000134438	Homeodomain	Known motif – High-throughput in vitro [758]	HTAATTR
RAX2	ENSG00000173976	Homeodomain	Known motif – High-throughput in vitro [759]	TAATTR
RBAK	ENSG00000146587	C2H2 ZF	Known motif – High-throughput in vitro [760]	VGDRASRARVRRSV
RBCK1	ENSG00000125826	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [761]
RBPJ	ENSG00000168214	CSL	Known motif – High-throughput in vitro [762]	BTCHCA
RBPJL	ENSG00000124232	CSL	Inferred motif from similar protein – In vivo/Misc source [763]	DTTCCCABR
RBSN	ENSG00000131381	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [764]
REL	ENSG00000162924	Rel	Known motif – In vivo/Misc source [765]	GGAAWNYCCV
RELA	ENSG00000173039	Rel	Known motif – In vivo/Misc source [766]	BKGGAAAKYCCCH
RELB	ENSG00000104856	Rel	Known motif – In vivo/Misc source [767]	DKSAAAKYCCCB
REPIN1	ENSG00000214022	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [768]
REST	ENSG00000084093	C2H2 ZF	Known motif – In vivo/Misc source [769]	DTCAGSACCWYGGACAGCDSC
REXO4	ENSG00000148300	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [770]
RFX1	ENSG00000132005	RFX	Known motif – High-throughput in vitro [771]	BGTTRYCATGRYAACV
RFX2	ENSG00000087903	RFX	Known motif – High-throughput in vitro [772]	BGTTRCCATGGYAACV
RFX3	ENSG00000080298	RFX	Known motif – High-throughput in vitro [773]	BGTTDCCATGGYAAC
RFX4	ENSG00000111783	RFX	Known motif – High-throughput in vitro [774]	GTWRYCATRGHWAC
RFX5	ENSG00000143390	RFX	Known motif – High-throughput in vitro [775]	BGTTGCYATGGYAACV
RFX6	ENSG00000185002	RFX	Inferred motif from similar protein – High-throughput in vitro [776]	GTHDYYNNS
RFX7	ENSG00000181827	RFX	Known motif – High-throughput in vitro [777]	BGTTRCYRY
RFX8	ENSG00000196460	RFX	Likely sequence specific TF according to literature or domain structure – No motif [778]
RHOXF1	ENSG00000101883	Homeodomain	Known motif – High-throughput in vitro [779]	TRAKCCH
RHOXF2	ENSG00000131721	Homeodomain	Known motif – High-throughput in vitro [780]	TAATCC
RHOXF2B	ENSG00000203989	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [781]	TAATCC
RLF	ENSG00000117000	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [782]
RORA	ENSG00000069667	Nuclear receptor	Known motif – High-throughput in vitro [783]	MRAGGTCAAVYYVAGGTCA
RORB	ENSG00000198963	Nuclear receptor	Known motif – High-throughput in vitro [784]	AWNBRGGTCA
RORC	ENSG00000143365	Nuclear receptor	Known motif – High-throughput in vitro [785]	TGMCCYANWTH
RREB1	ENSG00000124782	C2H2 ZF	Known motif – In vivo/Misc source [786]	MCMCMAMMCAMCMMCHMMSV
RUNX1	ENSG00000159216	Runt	Known motif – In vivo/Misc source [787]	VACCACAV
RUNX2	ENSG00000124813	Runt	Known motif – High-throughput in vitro [788]	HRACCRCADWAACCRCAV
RUNX3	ENSG00000020633	Runt	Known motif – High-throughput in vitro [789]	WAACCRCAR
RXRA	ENSG00000186350	Nuclear receptor	Known motif – High-throughput in vitro [790]	RRGGTCAAAGGTCA
RXRB	ENSG00000204231	Nuclear receptor	Known motif – High-throughput in vitro [791]	RRGGTCAAAGGTCA
RXRG	ENSG00000143171	Nuclear receptor	Known motif – High-throughput in vitro [792]	RRGGTCAAAGGTCA
SAFB	ENSG00000160633	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [793]
SAFB2	ENSG00000130254	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [794]
SALL1	ENSG00000103449	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [795]	RYYCAAAAB
SALL2	ENSG00000165821	C2H2 ZF	Known motif – In vivo/Misc source [796]	CCCACCC
SALL3	ENSG00000256463	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [797]
SALL4	ENSG00000101115	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [798]	GCTGATAACAGV
SATB1	ENSG00000182568	CUT; Homeodomain	Known motif – In vivo/Misc source [799]	WKWWWTAAHGRYMNWW
SATB2	ENSG00000119042	CUT; Homeodomain	Inferred motif from similar protein – In vivo/Misc source [800]	WKWWWTAAHGRYMNWW
SCMH1	ENSG00000010803	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [801]
SCML4	ENSG00000146285	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [802]
SCRT1	ENSG00000261678	C2H2 ZF	Known motif – High-throughput in vitro [803]	KCAACAGGTD
SCRT2	ENSG00000215397	C2H2 ZF	Known motif – High-throughput in vitro [804]	RHGCAACAGGTGB
SCX	ENSG00000260428	bHLH	Inferred motif from similar protein – High-throughput in vitro [805]	VCRKMYGB
SEBOX	ENSG00000274529	Homeodomain	Inferred motif from similar protein – High-throughput in vitro [806]	HTTAATTA
SETBP1	ENSG00000152217	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [807]
SETDB1	ENSG00000143379	MBD	Known motif – In vivo/Misc source [808]	RACTHCMDYTCCCRKVRDGCHNYG
SETDB2	ENSG00000136169	MBD	Likely sequence specific TF according to literature or domain structure – No motif [809]
SGSM2	ENSG00000141258	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [810]
SHOX	ENSG00000185960	Homeodomain	Known motif – High-throughput in vitro [811]	TAATTR
SHOX2	ENSG00000168779	Homeodomain	Known motif – High-throughput in vitro [812]	BTAATTR
SIM1	ENSG00000112246	bHLH	Inferred motif from similar protein – In vivo/Misc source [813]	VVNGCACGTMBNS
SIM2	ENSG00000159263	bHLH	Inferred motif from similar protein – In vivo/Misc source [814]	VVNGCACGTMBNS
SIX1	ENSG00000126778	Homeodomain	Known motif – High-throughput in vitro [815]	VBGTATCR
SIX2	ENSG00000170577	Homeodomain	Known motif – High-throughput in vitro [816]	VSGTATCR
SIX3	ENSG00000138083	Homeodomain	Known motif – High-throughput in vitro [817]	VVTATCR
SIX4	ENSG00000100625	Homeodomain	Known motif – High-throughput in vitro [818]	VBGTATCRB
SIX5	ENSG00000177045	Homeodomain	Known motif – In vivo/Misc source [819]	GGAGTTGT
SIX6	ENSG00000184302	Homeodomain	Known motif – High-throughput in vitro [820]	VBSTATCR
SKI	ENSG00000157933	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [821]
SKIL	ENSG00000136603	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [822]
SKOR1	ENSG00000188779	Unknown	Known motif – High-throughput in vitro [823]	WNVKGTAATTAMB
SKOR2	ENSG00000215474	SAND	Known motif – High-throughput in vitro [824]	WNVKGTAATTAA
SLC2A4RG	ENSG00000125520	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [825]
SMAD1	ENSG00000170365	SMAD	Known motif – In vivo/Misc source [826]	DRCAGASAGGSH
SMAD3	ENSG00000166949	SMAD	Known motif – High-throughput in vitro [827]	YGTCTAGACA
SMAD4	ENSG00000141646	SMAD	Known motif – from protein with 100% identical DBD – in vitro [828]	KCYAGACR
SMAD5	ENSG00000113658	SMAD	Known motif – High-throughput in vitro [829]	YGTCTAGACW
SMAD9	ENSG00000120693	SMAD	Known motif – In vivo/Misc source [830]	WGGTCTAGMCMT
SMYD3	ENSG00000185420	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [831]
SNAI1	ENSG00000124216	C2H2 ZF	Known motif – High-throughput in vitro [832]	VCACCTGY
SNAI2	ENSG00000019549	C2H2 ZF	Known motif – High-throughput in vitro [833]	RRCAGGTGYR
SNAI3	ENSG00000185669	C2H2 ZF	Known motif – High-throughput in vitro [834]	DRCAGGTGYR
SNAPC2	ENSG00000104976	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [835]
SNAPC4	ENSG00000165684	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [836]
SNAPC5	ENSG00000174446	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [837]
SOHLH1	ENSG00000165643	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [838]
SOHLH2	ENSG00000120669	bHLH	Known motif – High-throughput in vitro [839]	BCACGTGC
SON	ENSG00000159140	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [840]
SOX1	ENSG00000182968	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [841]	WBAAW
SOX10	ENSG00000100146	HMG/Sox	Known motif – High-throughput in vitro [842]	DAACAWWGVV
SOX11	ENSG00000176887	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [843]	VACAAW
SOX12	ENSG00000177732	HMG/Sox	Known motif – High-throughput in vitro [844]	MCCGAACAAT
SOX13	ENSG00000143842	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [845]	RAACAATW
SOX14	ENSG00000168875	HMG/Sox	Known motif – High-throughput in vitro [846]	WCAATR
SOX15	ENSG00000129194	HMG/Sox	Known motif – High-throughput in vitro [847]	ATCAATAMCATTGAT
SOX17	ENSG00000164736	HMG/Sox	Known motif – High-throughput in vitro [848]	DRACAATRV
SOX18	ENSG00000203883	HMG/Sox	Known motif – High-throughput in vitro [849]	ATCAATGHWATTGAT
SOX2	ENSG00000181449	HMG/Sox	Known motif – High-throughput in vitro [850]	HATCAATANCATTGATH
SOX21	ENSG00000125285	HMG/Sox	Known motif – High-throughput in vitro [851]	TCAMTRHCATTGA
SOX3	ENSG00000134595	HMG/Sox	Known motif – High-throughput in vitro [852]	SBNAMAATRB
SOX30	ENSG00000039600	HMG/Sox	Known motif – High-throughput in vitro [853]	RACAAT
SOX4	ENSG00000124766	HMG/Sox	Known motif – High-throughput in vitro [854]	AACAAWGR
SOX5	ENSG00000134532	HMG/Sox	Known motif – High-throughput in vitro [855]	DVACAATRV
SOX6	ENSG00000110693	HMG/Sox	Known motif – High-throughput in vitro [856]	DRACAATRV
SOX7	ENSG00000171056	HMG/Sox	Known motif – High-throughput in vitro [857]	DAACAATKDYAKTGTT
SOX8	ENSG00000005513	HMG/Sox	Known motif – High-throughput in vitro [858]	HATCAATTKCAGTGAT
SOX9	ENSG00000125398	HMG/Sox	Known motif – High-throughput in vitro [859]	DDACAATRV
SP1	ENSG00000185591	C2H2 ZF	Known motif – High-throughput in vitro [860]	RCCMCDCCCMH
SP100	ENSG00000067066	SAND	Likely sequence specific TF according to literature or domain structure – No motif [861]
SP110	ENSG00000135899	SAND	Likely sequence specific TF according to literature or domain structure – No motif [862]
SP140	ENSG00000079263	SAND	Likely sequence specific TF according to literature or domain structure – No motif [863]
SP140L	ENSG00000185404	SAND	Likely sequence specific TF according to literature or domain structure – No motif [864]
SP2	ENSG00000167182	C2H2 ZF	Known motif – High-throughput in vitro [865]	YWAGYCCCGCCCMCYH
SP3	ENSG00000172845	C2H2 ZF	Known motif – High-throughput in vitro [866]	VCCMCRCCCMY
SP4	ENSG00000105866	C2H2 ZF	Known motif – High-throughput in vitro [867]	WRGCCACGCCCMCHY
SP5	ENSG00000204335	C2H2 ZF	Known motif – In vivo/Misc source [868]	ACCVCGCCKCCSS
SP6	ENSG00000189120	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [869]	HNGCCACGCCCARK
SP7	ENSG00000170374	C2H2 ZF	Known motif – In vivo/Misc source [870]	VBNSGGGGNGG
SP8	ENSG00000164651	C2H2 ZF	Known motif – High-throughput in vitro [871]	VMCACBCCCMCH
SP9	ENSG00000217236	C2H2 ZF	Known motif – High-throughput in vitro [872]	VMCMCGCCCMYH
SPDEF	ENSG00000124664	Ets	Known motif – High-throughput in vitro [873]	AMCCGGATRTD
SPEN	ENSG00000065526	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [874]
SPI1	ENSG00000066336	Ets	Known motif – High-throughput in vitro [875]	RAAAAGMGGAAGTW
SPIB	ENSG00000269404	Ets	Known motif – High-throughput in vitro [876]	WWWRVGGAAST
SPIC	ENSG00000166211	Ets	Known motif – High-throughput in vitro [877]	RAAWSVGGAAGTM
SPZ1	ENSG00000164299	Unknown	Known motif – In vivo/Misc source [878]	GGSDGWWMCVBHBG
SRCAP	ENSG00000080603	AT hook	Likely sequence specific TF according to literature or domain structure – No motif [879]
SREBF1	ENSG00000072310	bHLH	Known motif – High-throughput in vitro [880]	VHCACVCSAY
SREBF2	ENSG00000198911	bHLH	Known motif – High-throughput in vitro [881]	RTCACGTGAY
SRF	ENSG00000112658	MADS box	Known motif – High-throughput in vitro [882]	DCCWTATATGGT
SRY	ENSG00000184895	HMG/Sox	Known motif – High-throughput in vitro [883]	AACAATGNTATTGTT
ST18	ENSG00000147488	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [884]	VAAGTTT
STAT1	ENSG00000115415	STAT	Known motif – In vivo/Misc source [885]	HTTCCYRGAAR
STAT2	ENSG00000170581	STAT	Known motif – In vivo/Misc source [886]	TNRGTTTCDNTTYC
STAT3	ENSG00000168610	STAT	Known motif – In vivo/Misc source [887]	HTTCCYRKMA
STAT4	ENSG00000138378	STAT	Known motif – In vivo/Misc source [888]	BDHTTCTBGKAAD
STAT5A	ENSG00000126561	STAT	Known motif – In vivo/Misc source [889]	YTTCYNRGAAHY
STAT5B	ENSG00000173757	STAT	Known motif – In vivo/Misc source [890]	ADTTCYHRGAAA
STAT6	ENSG00000166888	STAT	Known motif – In vivo/Misc source [891]	DWTTYCNDDGAA
T	ENSG00000164458	T-box	Known motif – High-throughput in vitro [892]	ANGTGYGAHWWNTVRCACCT
TAL1	ENSG00000162367	bHLH	Known motif – In vivo/Misc source [893]	RNCAGVTGGH
TAL2	ENSG00000186051	bHLH	Inferred motif from similar protein – In vivo/Misc source [894]	RNCAGVTGGH
TBP	ENSG00000112592	TBP	Known motif – from protein with 100% identical DBD – in vitro [895]	WWWWAW
TBPL1	ENSG00000028839	TBP	Likely sequence specific TF according to literature or domain structure – No motif [896]
TBPL2	ENSG00000182521	TBP	Inferred motif from similar protein – High-throughput in vitro [897]	WWWWAW
TBR1	ENSG00000136535	T-box	Known motif – High-throughput in vitro [898]	TTCACACCT
TBX1	ENSG00000184058	T-box	Known motif – High-throughput in vitro [899]	TCACACCT
TBX10	ENSG00000167800	T-box	Inferred motif from similar protein – High-throughput in vitro [900]	BYTCACACCYHV
TBX15	ENSG00000092607	T-box	Known motif – High-throughput in vitro [901]	TCACACCT
TBX18	ENSG00000112837	T-box	Known motif – High-throughput in vitro [902]	BYTCACACCTHH
TBX19	ENSG00000143178	T-box	Known motif – High-throughput in vitro [903]	TMRCACNTABGTGYBAH
TBX2	ENSG00000121068	T-box	Known motif – High-throughput in vitro [904]	VRCRC
TBX20	ENSG00000164532	T-box	Known motif – High-throughput in vitro [905]	TCACRCBYTMACACCT
TBX21	ENSG00000073861	T-box	Known motif – High-throughput in vitro [906]	WTCACACCTH
TBX22	ENSG00000122145	T-box	Known motif – In vivo/Misc source [907]	AGGTGWSAAWTTCACACCT
TBX3	ENSG00000135111	T-box	Known motif – High-throughput in vitro [908]	YVACACSH
TBX4	ENSG00000121075	T-box	Known motif – High-throughput in vitro [909]	TVACACCT
TBX5	ENSG00000089225	T-box	Known motif – High-throughput in vitro [910]	TVACACCT
TBX6	ENSG00000149922	T-box	Known motif – High-throughput in vitro [911]	TVACACSY
TCF12	ENSG00000140262	bHLH	Known motif – High-throughput in vitro [912]	VCACSTGB
TCF15	ENSG00000125878	bHLH	Inferred motif from similar protein – High-throughput in vitro [913]	VCRKMYGB
TCF20	ENSG00000100207	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [914]
TCF21	ENSG00000118526	bHLH	Known motif – High-throughput in vitro [915]	RVCAGCTGTTV
TCF23	ENSG00000163792	bHLH	Inferred motif from similar protein – High-throughput in vitro [916]	VCRKMYGB
TCF24	ENSG00000261787	bHLH	Inferred motif from similar protein – High-throughput in vitro [917]	RMCAKMTGK
TCF3	ENSG00000071564	bHLH	Known motif – High-throughput in vitro [918]	VCAGGTGB
TCF4	ENSG00000196628	bHLH	Known motif – High-throughput in vitro [919]	HRCACCTGB
TCF7	ENSG00000081059	HMG/Sox	Known motif – High-throughput in vitro [920]	DSATCAAWS
TCF7L1	ENSG00000152284	HMG/Sox	Known motif – High-throughput in vitro [921]	AAAGATCAAAGG
TCF7L2	ENSG00000148737	HMG/Sox	Known motif – from protein with 100% identical DBD – in vitro [922]	SWTCAAAV
TCFL5	ENSG00000101190	bHLH	Known motif – High-throughput in vitro [923]	KCRCGCGCHC
TEAD1	ENSG00000187079	TEA	Known motif – High-throughput in vitro [924]	RCATTCCDH
TEAD2	ENSG00000074219	TEA	Known motif – High-throughput in vitro [925]	YRCATTCCW
TEAD3	ENSG00000007866	TEA	Known motif – High-throughput in vitro [926]	RCATTCYDNDCATWCCD
TEAD4	ENSG00000197905	TEA	Known motif – High-throughput in vitro [927]	RMATTCYD
TEF	ENSG00000167074	bZIP	Known motif – High-throughput in vitro [928]	VTTACRTAAB
TERB1	ENSG00000249961	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [929]
TERF1	ENSG00000147601	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [930]
TERF2	ENSG00000132604	Myb/SANT	Inferred motif from similar protein – High-throughput in vitro [931]	AACCCTAV
TET1	ENSG00000138336	CxxC	Known motif – High-throughput in vitro [932]	HVCGH
TET2	ENSG00000168769	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [933]
TET3	ENSG00000187605	CxxC	Likely sequence specific TF according to literature or domain structure – No motif [934]
TFAP2A	ENSG00000137203	AP-2	Known motif – High-throughput in vitro [935]	HSCCYBVRGGCD
TFAP2B	ENSG00000008196	AP-2	Known motif – High-throughput in vitro [936]	SCCBNVGGS
TFAP2C	ENSG00000087510	AP-2	Known motif – High-throughput in vitro [937]	HGCCYBVRGGSD
TFAP2D	ENSG00000008197	AP-2	Known motif – In vivo/Misc source [938]	RCGNGCCBCRGVCB
TFAP2E	ENSG00000116819	AP-2	Known motif – High-throughput in vitro [939]	HSCCYSRGGSD
TFAP4	ENSG00000090447	bHLH	Known motif – High-throughput in vitro [940]	VWCAGCTGWB
TFCP2	ENSG00000135457	Grainyhead	Known motif – High-throughput in vitro [941]	WCCGGWWHDAWCYGGW
TFCP2L1	ENSG00000115112	Grainyhead	Known motif – High-throughput in vitro [942]	DCYRGHNNNDDCYRGH
TFDP1	ENSG00000198176	E2F	Known motif – In vivo/Misc source [943]	DYYTCSCGCYMWWY
TFDP2	ENSG00000114126	E2F	Inferred motif from similar protein – In vivo/Misc source [944]	DYYTCSCGCYMWWY
TFDP3	ENSG00000183434	E2F	Inferred motif from similar protein – In vivo/Misc source [945]	DYYTCSCGCYMWWY
TFE3	ENSG00000068323	bHLH	Known motif – High-throughput in vitro [946]	RKCACGTGNB
TFEB	ENSG00000112561	bHLH	Known motif – High-throughput in vitro [947]	RNCACGTGAY
TFEC	ENSG00000105967	bHLH	Known motif – High-throughput in vitro [948]	RNCACRTGAB
TGIF1	ENSG00000177426	Homeodomain	Known motif – High-throughput in vitro [949]	TGACAGCTGTCA
TGIF2	ENSG00000118707	Homeodomain	Known motif – High-throughput in vitro [950]	TGACABVTGTCA
TGIF2LX	ENSG00000153779	Homeodomain	Known motif – High-throughput in vitro [951]	TGACASSTGTCA
TGIF2LY	ENSG00000176679	Homeodomain	Known motif – High-throughput in vitro [952]	TGACABVTGTCA
THAP1	ENSG00000131931	THAP finger	Known motif – In vivo/Misc source [953]	BYYGCCMKNANYMAAVATGGCSV
THAP10	ENSG00000129028	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [954]
THAP11	ENSG00000168286	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [955]
THAP12	ENSG00000137492	THAP finger	Known motif – High-throughput in vitro [956]	YMBNNBGR
THAP2	ENSG00000173451	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [957]
THAP3	ENSG00000041988	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [958]
THAP4	ENSG00000176946	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [959]
THAP5	ENSG00000177683	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [960]
THAP6	ENSG00000174796	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [961]
THAP7	ENSG00000184436	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [962]
THAP8	ENSG00000161277	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [963]
THAP9	ENSG00000168152	THAP finger	Likely sequence specific TF according to literature or domain structure – No motif [964]
THRA	ENSG00000126351	Nuclear receptor	Known motif – High-throughput in vitro [965]	DTGACCTBATRAGGTCAH
THRB	ENSG00000151090	Nuclear receptor	Known motif – High-throughput in vitro [966]	TGWCCTBRNYVAGGWCA
THYN1	ENSG00000151500	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [967]
TIGD1	ENSG00000221944	CENPB	Known motif – High-throughput in vitro [968]	SCGCAATA
TIGD2	ENSG00000180346	CENPB	Inferred motif from similar protein – High-throughput in vitro [969]	RCGGWWR
TIGD3	ENSG00000173825	CENPB	Likely sequence specific TF according to literature or domain structure – No motif [970]
TIGD4	ENSG00000169989	CENPB	Likely sequence specific TF according to literature or domain structure – No motif [971]
TIGD5	ENSG00000179886	CENPB	Likely sequence specific TF according to literature or domain structure – No motif [972]
TIGD6	ENSG00000164296	CENPB	Inferred motif from similar protein – High-throughput in vitro [973]	WVCRWA
TIGD7	ENSG00000140993	CENPB	Likely sequence specific TF according to literature or domain structure – No motif [974]
TLX1	ENSG00000107807	Homeodomain	Known motif – In vivo/Misc source [975]	VCHHVTTRVCV
TLX2	ENSG00000115297	Homeodomain	Known motif – High-throughput in vitro [976]	BTAATTR
TLX3	ENSG00000164438	Homeodomain	Known motif – High-throughput in vitro [977]	AATKGNNNNNNNNNNNNNCAATT
TMF1	ENSG00000144747	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [978]
TOPORS	ENSG00000197579	Unknown	Known motif – In vivo/Misc source [979]	TCCCAGCTACTTTGGGA
TP53	ENSG00000141510	p53	Known motif – In vivo/Misc source [980]	DRCATGYYBRGRCATGYCY
TP63	ENSG00000073282	p53	Known motif – High-throughput in vitro [981]	DACATGTYVYRACATGTY
TP73	ENSG00000078900	p53	Known motif – In vivo/Misc source [982]	DRRCAWGYHCWGRCWTGYH
TPRX1	ENSG00000178928	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [983]
TRAFD1	ENSG00000135148	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [984]
TRERF1	ENSG00000124496	C2H2 ZF; Myb/SANT	Inferred motif from similar protein – In vivo/Misc source [985]	AGACKTTAGTCA
TRPS1	ENSG00000104447	GATA	Known motif – In vivo/Misc source [986]	HWSRARATAGWDDMH
TSC22D1	ENSG00000102804	Unknown	Likely sequence specific TF according to literature or domain structure – No motif [987]
TSHZ1	ENSG00000179981	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [988]
TSHZ2	ENSG00000182463	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [989]
TSHZ3	ENSG00000121297	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [990]
TTF1	ENSG00000125482	Myb/SANT	Likely sequence specific TF according to literature or domain structure – No motif [991]
TWIST1	ENSG00000122691	bHLH	Known motif – In vivo/Misc source [992]	MHVCACHTGSD
TWIST2	ENSG00000233608	bHLH	Known motif – from protein with 100% identical DBD – in vitro [993]	MCATATGT
UBP1	ENSG00000153560	Grainyhead	Known motif – High-throughput in vitro [994]	DCYRGHNNNNDCYRGH
UNCX	ENSG00000164853	Homeodomain	Known motif – High-throughput in vitro [995]	TAATTR
USF1	ENSG00000158773	bHLH	Known motif – High-throughput in vitro [996]	RNCACGTGRY
USF2	ENSG00000105698	bHLH	Known motif – High-throughput in vitro [997]	VCACGTGVC
USF3	ENSG00000176542	bHLH	Likely sequence specific TF according to literature or domain structure – No motif [998]
VAX1	ENSG00000148704	Homeodomain	Known motif – High-throughput in vitro [999]	YTAATKA
VAX2	ENSG00000116035	Homeodomain	Known motif – High-throughput in vitro [1,000]	YTAATKA
VDR	ENSG00000111424	Nuclear receptor	Known motif – High-throughput in vitro [1,001]	TGAACYCDRTGAACYC
VENTX	ENSG00000151650	Homeodomain	Known motif – High-throughput in vitro [1,002]	VNTAATBR
VEZF1	ENSG00000136451	C2H2 ZF	Known motif – High-throughput in vitro [1,003]	RKGGGGGG
VSX1	ENSG00000100987	Homeodomain	Known motif – High-throughput in vitro [1,004]	TAATTRS
VSX2	ENSG00000119614	Homeodomain	Known motif – High-throughput in vitro [1,005]	YTAATTA
WIZ	ENSG00000011451	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,006]
WT1	ENSG00000184937	C2H2 ZF	Known motif – High-throughput in vitro [1,007]	BGGGGGRG
XBP1	ENSG00000100219	bZIP	Known motif – High-throughput in vitro [1,008]	GVTGACGTGKCVHW
XPA	ENSG00000136936	Unknown	Known motif – High-throughput in vitro [1,009]	VCACCTCACMY
YBX1	ENSG00000065978	CSD	Known motif – High-throughput in vitro [1,010]	YGTWCCAYC
YBX2	ENSG00000006047	CSD	Inferred motif from similar protein – High-throughput in vitro [1,011]	YGTWCCAYC
YBX3	ENSG00000060138	CSD	Known motif – from protein with 100% identical DBD – in vitro [1,012]	YGTWCCAYC
YY1	ENSG00000100811	C2H2 ZF	Known motif – High-throughput in vitro [1,013]	HRWNATGGCB
YY2	ENSG00000230797	C2H2 ZF	Known motif – High-throughput in vitro [1,014]	DDNATGGCGG
ZBED1	ENSG00000214717	BED ZF	Known motif – High-throughput in vitro [1,015]	YATGTCGCGAYAD
ZBED2	ENSG00000177494	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,016]
ZBED3	ENSG00000132846	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,017]
ZBED4	ENSG00000100426	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,018]
ZBED5	ENSG00000236287	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,019]
ZBED6	ENSG00000257315	BED ZF	Inferred motif from similar protein – In vivo/Misc source [1,020]	VVRGCGAGCYYV
ZBED9	ENSG00000232040	BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,021]
ZBTB1	ENSG00000126804	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [1,022]	HMMCGCRH
ZBTB10	ENSG00000205189	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,023]
ZBTB11	ENSG00000066422	C2H2 ZF	Known motif – In vivo/Misc source [1,024]	GGGGKGCRCMCA
ZBTB12	ENSG00000204366	C2H2 ZF	Known motif – High-throughput in vitro [1,025]	CTAGAACMB
ZBTB14	ENSG00000198081	C2H2 ZF	Known motif – High-throughput in vitro [1,026]	VDCGTGCACGCGCRH
ZBTB16	ENSG00000109906	C2H2 ZF	Known motif – In vivo/Misc source [1,027]	BTVNWYBKVHKBTAAADYWKKRHYWRDKY
ZBTB17	ENSG00000116809	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,028]
ZBTB18	ENSG00000179456	C2H2 ZF	Known motif – High-throughput in vitro [1,029]	DKCCAGATGTK
ZBTB2	ENSG00000181472	C2H2 ZF	Known motif – High-throughput in vitro [1,030]	DKWACCGGRA
ZBTB20	ENSG00000181722	C2H2 ZF	Known motif – High-throughput in vitro [1,031]	VYATACRTYV
ZBTB21	ENSG00000173276	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,032]
ZBTB22	ENSG00000236104	C2H2 ZF	Known motif – High-throughput in vitro [1,033]	HKCACWAYNRTWGTGMD
ZBTB24	ENSG00000112365	C2H2 ZF; AT hook	Likely sequence specific TF according to literature or domain structure – No motif [1,034]
ZBTB25	ENSG00000089775	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,035]
ZBTB26	ENSG00000171448	C2H2 ZF	Known motif – High-throughput in vitro [1,036]	DHTCYAGAAHR
ZBTB3	ENSG00000185670	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [1,037]	DSCAGYK
ZBTB32	ENSG00000011590	C2H2 ZF	Known motif – High-throughput in vitro [1,038]	HGTACAGTRWYACTGTACD
ZBTB33	ENSG00000177485	C2H2 ZF	Known motif – In vivo/Misc source [1,039]	SVNTCTCGCGAGANB
ZBTB34	ENSG00000177125	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,040]	DTCGGCYAABDCGGCA
ZBTB37	ENSG00000185278	C2H2 ZF	Known motif – High-throughput in vitro [1,041]	DTCGGCYAABDCGGCA
ZBTB38	ENSG00000177311	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,042]
ZBTB39	ENSG00000166860	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,043]
ZBTB4	ENSG00000174282	C2H2 ZF	Known motif – In vivo/Misc source [1,044]	CVCHAHCRCYMTBG
ZBTB40	ENSG00000184677	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,045]
ZBTB41	ENSG00000177888	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,046]
ZBTB42	ENSG00000179627	C2H2 ZF	Known motif – High-throughput in vitro [1,047]	MRCAKCTGS
ZBTB43	ENSG00000169155	C2H2 ZF	Known motif – High-throughput in vitro [1,048]	GTGCTRNNNNNDDGGCAC
ZBTB44	ENSG00000196323	C2H2 ZF	Known motif – High-throughput in vitro [1,049]	RMTGCAKB
ZBTB45	ENSG00000119574	C2H2 ZF	Known motif – High-throughput in vitro [1,050]	BMTATAGGBR
ZBTB46	ENSG00000130584	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,051]
ZBTB47	ENSG00000114853	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,052]
ZBTB48	ENSG00000204859	C2H2 ZF	Known motif – In vivo/Misc source [1,053]	YHAGGGANHDD
ZBTB49	ENSG00000168826	C2H2 ZF	Known motif – High-throughput in vitro [1,054]	TGACVBGYCARGCRRAA
ZBTB5	ENSG00000168795	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,055]
ZBTB6	ENSG00000186130	C2H2 ZF	Known motif – In vivo/Misc source [1,056]	VGRTGMTRGAGCC
ZBTB7A	ENSG00000178951	C2H2 ZF	Known motif – High-throughput in vitro [1,057]	RCGACCACCNV
ZBTB7B	ENSG00000160685	C2H2 ZF	Known motif – High-throughput in vitro [1,058]	DCGACCMCCVA
ZBTB7C	ENSG00000184828	C2H2 ZF	Known motif – High-throughput in vitro [1,059]	DCRACCACCVH
ZBTB8A	ENSG00000160062	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,060]
ZBTB8B	ENSG00000273274	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,061]
ZBTB9	ENSG00000213588	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,062]
ZC3H8	ENSG00000144161	CCCH ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,063]
ZEB1	ENSG00000148516	C2H2 ZF; Homeodomain	Known motif – In vivo/Misc source [1,064]	CAGGTGNR
ZEB2	ENSG00000169554	C2H2 ZF; Homeodomain	Inferred motif from similar protein – In vivo/Misc source [1,065]	CAGGTGNR
ZFAT	ENSG00000066827	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,066]
ZFHX2	ENSG00000136367	Homeodomain	Known motif – High-throughput in vitro [1,067]	TRATYA
ZFHX3	ENSG00000140836	C2H2 ZF; Homeodomain	Known motif – High-throughput in vitro [1,068]	RMTND
ZFHX4	ENSG00000091656	C2H2 ZF; Homeodomain	Inferred motif from similar protein – In vivo/Misc source [1,069]	WAATWAWTAAY
ZFP1	ENSG00000184517	C2H2 ZF	Known motif – High-throughput in vitro [1,070]	TDYBATACCCANHH
ZFP14	ENSG00000142065	C2H2 ZF	Known motif – High-throughput in vitro [1,071]	GGAGSHHHHDGARHK
ZFP2	ENSG00000198939	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,072]	RGRAAVYGAAACT
ZFP28	ENSG00000196867	C2H2 ZF	Known motif – High-throughput in vitro [1,073]	AYMNHWRARGAAAHDGARMKVHHDNDNNDNNH
ZFP3	ENSG00000180787	C2H2 ZF	Known motif – High-throughput in vitro [1,074]	GGNTGNRTAGGAGYTYDB
ZFP30	ENSG00000120784	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,075]	RAHRNRGYTRNRDRNRG
ZFP37	ENSG00000136866	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,076]
ZFP41	ENSG00000181638	C2H2 ZF	Known motif – High-throughput in vitro [1,077]	RYGGAGAGTTAGC
ZFP42	ENSG00000179059	C2H2 ZF	Known motif – High-throughput in vitro [1,078]	CAAKATGGCBGHC
ZFP57	ENSG00000204644	C2H2 ZF	Known motif – In vivo/Misc source [1,079]	SNNVNNVBTGCCGCV
ZFP62	ENSG00000196670	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,080]
ZFP64	ENSG00000020256	C2H2 ZF	Known motif – In vivo/Misc source [1,081]	VGGRSCCCGGGVVNS
ZFP69	ENSG00000187815	C2H2 ZF	Known motif – High-throughput in vitro [1,082]	GWGRCTRGAWAC
ZFP69B	ENSG00000187801	C2H2 ZF	Known motif – High-throughput in vitro [1,083]	GTGGCTGGARVV
ZFP82	ENSG00000181007	C2H2 ZF	Known motif – High-throughput in vitro [1,084]	AGAATTAGTRAAYTGGAARAY
ZFP90	ENSG00000184939	C2H2 ZF	Known motif – High-throughput in vitro [1,085]	RYACTGCTTTWG
ZFP91	ENSG00000186660	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,086]
ZFP92	ENSG00000189420	C2H2 ZF	Known motif – In vivo/Misc source [1,087]	MGATAAAAKGM
ZFPM1	ENSG00000179588	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,088]
ZFPM2	ENSG00000169946	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,089]
ZFX	ENSG00000005889	C2H2 ZF	Known motif – In vivo/Misc source [1,090]	VVSVSBNBBAGGCCBVGSH
ZFY	ENSG00000067646	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,091]	BAGGCCBVGSYBVV
ZGLP1	ENSG00000220201	GATA	Likely sequence specific TF according to literature or domain structure – No motif [1,092]
ZGPAT	ENSG00000197114	CCCH ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,093]
ZHX1	ENSG00000165156	Homeodomain	Known motif – High-throughput in vitro [1,094]	DYB
ZHX2	ENSG00000178764	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [1,095]
ZHX3	ENSG00000174306	Homeodomain	Likely sequence specific TF according to literature or domain structure – No motif [1,096]
ZIC1	ENSG00000152977	C2H2 ZF	Known motif – High-throughput in vitro [1,097]	DCRCAGCRGGGGGBV
ZIC2	ENSG00000043355	C2H2 ZF	Known motif – from protein with 100% identical DBD – in vitro [1,098]	YNRBRKG
ZIC3	ENSG00000156925	C2H2 ZF	Known motif – High-throughput in vitro [1,099]	KCACAGCRGGGGGTCB
ZIC4	ENSG00000174963	C2H2 ZF	Known motif – High-throughput in vitro [1,100]	DCNCHRCRGGGGGYM
ZIC5	ENSG00000139800	C2H2 ZF	Known motif – High-throughput in vitro [1,101]	DCDCAGCGGGGGGTM
ZIK1	ENSG00000171649	C2H2 ZF	Known motif – High-throughput in vitro [1,102]	RDRRCAAWRGCAMNRVRWNNB
ZIM2	ENSG00000269699	C2H2 ZF	Known motif – In vivo/Misc source [1,103]	YCNBSYBSCYTYYYCHBCCVGCCYGKGGYY
ZIM3	ENSG00000141946	C2H2 ZF	Known motif – High-throughput in vitro [1,104]	RNHAACAGAAANCYM
ZKSCAN1	ENSG00000106261	C2H2 ZF	Known motif – High-throughput in vitro [1,105]	CCTACTAHGH
ZKSCAN2	ENSG00000155592	C2H2 ZF	Known motif – High-throughput in vitro [1,106]	RRRRRMMAC
ZKSCAN3	ENSG00000189298	C2H2 ZF	Known motif – High-throughput in vitro [1,107]	TCGAGGYTAGMCCA
ZKSCAN4	ENSG00000187626	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,108]
ZKSCAN5	ENSG00000196652	C2H2 ZF	Known motif – High-throughput in vitro [1,109]	DGGAGGTGA
ZKSCAN7	ENSG00000196345	C2H2 ZF	Known motif – High-throughput in vitro [1,110]	VYAHACTKTNRAGYGV
ZKSCAN8	ENSG00000198315	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,111]
ZMAT1	ENSG00000166432	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,112]
ZMAT4	ENSG00000165061	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,113]
ZNF10	ENSG00000256223	C2H2 ZF	Known motif – High-throughput in vitro [1,114]	TGAGGT
ZNF100	ENSG00000197020	C2H2 ZF	Known motif – High-throughput in vitro [1,115]	VBRNGGCGGCGGCNB
ZNF101	ENSG00000181896	C2H2 ZF	Known motif – High-throughput in vitro [1,116]	VDGYKGCCCCHGTRTCH
ZNF107	ENSG00000196247	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,117]
ZNF112	ENSG00000062370	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,118]
ZNF114	ENSG00000178150	C2H2 ZF	Known motif – In vivo/Misc source [1,119]	VSSSBSBVVSSBSSSSYHTWTATABVSB
ZNF117	ENSG00000152926	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,120]	GKGCWGCAGM
ZNF12	ENSG00000164631	C2H2 ZF	Known motif – High-throughput in vitro [1,121]	VYGCKRTAACAARYAKSMCC
ZNF121	ENSG00000197961	C2H2 ZF	Known motif – High-throughput in vitro [1,122]	VCDGGVCMRVDBWGYVNGRYCCH
ZNF124	ENSG00000196418	C2H2 ZF	Known motif – High-throughput in vitro [1,123]	AAGAAGGCTTTAATYRGG
ZNF131	ENSG00000172262	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,124]
ZNF132	ENSG00000131849	C2H2 ZF	Known motif – High-throughput in vitro [1,125]	VRGGARRGNRGGARG
ZNF133	ENSG00000125846	C2H2 ZF	Known motif – High-throughput in vitro [1,126]	DGRNMCAAMWNANGTAHAAKTGGHDNH
ZNF134	ENSG00000213762	C2H2 ZF	Known motif – High-throughput in vitro [1,127]	VYTMAKCAGKKGMNG
ZNF135	ENSG00000176293	C2H2 ZF	Known motif – High-throughput in vitro [1,128]	HHYTGAGGTYGAGCY
ZNF136	ENSG00000196646	C2H2 ZF	Known motif – High-throughput in vitro [1,129]	TTCTTGGTTGRCAGKTTT
ZNF138	ENSG00000197008	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,130]
ZNF14	ENSG00000105708	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,131]
ZNF140	ENSG00000196387	C2H2 ZF	Known motif – High-throughput in vitro [1,132]	GAGCGGAATTGYH
ZNF141	ENSG00000131127	C2H2 ZF	Known motif – High-throughput in vitro [1,133]	RVKGRGRGYGKCCCCC
ZNF142	ENSG00000115568	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,134]
ZNF143	ENSG00000166478	C2H2 ZF	Known motif – High-throughput in vitro [1,135]	YWCCCAYAATGCAYYG
ZNF146	ENSG00000167635	C2H2 ZF	Known motif – High-throughput in vitro [1,136]	GGARTAYTABDCAGC
ZNF148	ENSG00000163848	C2H2 ZF	Known motif – In vivo/Misc source [1,137]	DGKGGGRGGD
ZNF154	ENSG00000179909	C2H2 ZF	Known motif – High-throughput in vitro [1,138]	TGTCTAGTARRTCYD
ZNF155	ENSG00000204920	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,139]
ZNF157	ENSG00000147117	C2H2 ZF	Known motif – High-throughput in vitro [1,140]	KNNDNGYRYAYTGHWDNCCYYVCCADGHCH
ZNF16	ENSG00000170631	C2H2 ZF	Known motif – High-throughput in vitro [1,141]	GAGCCAYDGMRGGYKBTD
ZNF160	ENSG00000170949	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,142]
ZNF165	ENSG00000197279	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,143]
ZNF169	ENSG00000175787	C2H2 ZF	Known motif – High-throughput in vitro [1,144]	CTCCCT
ZNF17	ENSG00000186272	C2H2 ZF	Known motif – High-throughput in vitro [1,145]	VNBNNNNNSTKYMTGYTCHKGNNNV
ZNF174	ENSG00000103343	C2H2 ZF	Known motif – High-throughput in vitro [1,146]	GSCRAGTGAYYGNC
ZNF175	ENSG00000105497	C2H2 ZF	Known motif – In vivo/Misc source [1,147]	CYAYACAHRAYAADGAATACA
ZNF177	ENSG00000188629	C2H2 ZF	Known motif – High-throughput in vitro [1,148]	BTYGRTCKMRNKKNNVAGTCATD
ZNF18	ENSG00000154957	C2H2 ZF	Known motif – High-throughput in vitro [1,149]	SNRTTCACACY
ZNF180	ENSG00000167384	C2H2 ZF	Known motif – High-throughput in vitro [1,150]	VGGGVSNGGNGGSGRSBGSGGCVV
ZNF181	ENSG00000197841	C2H2 ZF	Known motif – High-throughput in vitro [1,151]	VYYYSWGSTWSTNGGRMKGMKGHB
ZNF182	ENSG00000147118	C2H2 ZF	Known motif – High-throughput in vitro [1,152]	AAAAMMAAAARMAAA
ZNF184	ENSG00000096654	C2H2 ZF	Known motif – High-throughput in vitro [1,153]	TGGWGARGA
ZNF189	ENSG00000136870	C2H2 ZF	Known motif – High-throughput in vitro [1,154]	VDGGAASRGMVDNDS
ZNF19	ENSG00000157429	C2H2 ZF	Known motif – High-throughput in vitro [1,155]	DRGGVBHHDGACRNNDV
ZNF195	ENSG00000005801	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,156]
ZNF197	ENSG00000186448	C2H2 ZF	Known motif – High-throughput in vitro [1,157]	RRRGWCARRRRVVVR
ZNF2	ENSG00000275111	C2H2 ZF	Known motif – High-throughput in vitro [1,158]	SCVCVGVGCYGCGC
ZNF20	ENSG00000132010	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,159]
ZNF200	ENSG00000010539	C2H2 ZF	Known motif – High-throughput in vitro [1,160]	BVNVSCGGAAGY
ZNF202	ENSG00000166261	C2H2 ZF	Known motif – In vivo/Misc source [1,161]	CSCNBCYYCCDCYBCYBSBBCSBSBSCYB
ZNF205	ENSG00000122386	C2H2 ZF	Known motif – In vivo/Misc source [1,162]	TGGAAT
ZNF207	ENSG00000010244	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,163]
ZNF208	ENSG00000160321	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,164]
ZNF211	ENSG00000121417	C2H2 ZF	Known motif – High-throughput in vitro [1,165]	HNYATATACCAB
ZNF212	ENSG00000170260	C2H2 ZF	Known motif – In vivo/Misc source [1,166]	CACACAHVHMCACRC
ZNF213	ENSG00000085644	C2H2 ZF	Known motif – High-throughput in vitro [1,167]	MGAMMBCRGGCGGMG
ZNF214	ENSG00000149050	C2H2 ZF	Known motif – High-throughput in vitro [1,168]	VWTMATYAANRTCCTCAAVAABD
ZNF215	ENSG00000149054	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,169]
ZNF217	ENSG00000171940	C2H2 ZF	Known motif – In vivo/Misc source [1,170]	GKNRGAAT
ZNF219	ENSG00000165804	C2H2 ZF	Known motif – In vivo/Misc source [1,171]	DGGGGGGYGGW
ZNF22	ENSG00000165512	C2H2 ZF	Known motif – High-throughput in vitro [1,172]	AAAAAAAAA
ZNF221	ENSG00000159905	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,173]
ZNF222	ENSG00000159885	C2H2 ZF	Known motif – High-throughput in vitro [1,174]	GCTGMSAYB
ZNF223	ENSG00000178386	C2H2 ZF	Known motif – In vivo/Misc source [1,175]	MCACACASASM
ZNF224	ENSG00000267680	C2H2 ZF	Known motif – High-throughput in vitro [1,176]	WMCYYNKGDGYHMHRKGRMTY
ZNF225	ENSG00000256294	C2H2 ZF	Known motif – In vivo/Misc source [1,177]	TTAYCWKYDKNRYTTYTTTYTTTTTYYH
ZNF226	ENSG00000167380	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,178]
ZNF227	ENSG00000131115	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,179]
ZNF229	ENSG00000278318	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,180]
ZNF23	ENSG00000167377	C2H2 ZF	Known motif – High-throughput in vitro [1,181]	DCRMCCATGGCCGCGHCM
ZNF230	ENSG00000159882	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,182]
ZNF232	ENSG00000167840	C2H2 ZF	Known motif – High-throughput in vitro [1,183]	RTGTTAAAYGTRGATTAAS
ZNF233	ENSG00000159915	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,184]
ZNF234	ENSG00000263002	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,185]
ZNF235	ENSG00000159917	C2H2 ZF	Known motif – High-throughput in vitro [1,186]	AARARADRAARRAAAWNRDDWDVDNNAWDR
ZNF236	ENSG00000130856	C2H2 ZF	Known motif – In vivo/Misc source [1,187]	MGTAATATTVM
ZNF239	ENSG00000196793	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,188]
ZNF24	ENSG00000172466	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,189]
ZNF248	ENSG00000198105	C2H2 ZF	Known motif – High-throughput in vitro [1,190]	RHDDACHATRTYCAKBRA
ZNF25	ENSG00000175395	C2H2 ZF	Known motif – In vivo/Misc source [1,191]	WGAADWANAVARGTYGCWGCATTTAGAAA
ZNF250	ENSG00000196150	C2H2 ZF	Known motif – High-throughput in vitro [1,192]	YASGCCYAY
ZNF251	ENSG00000198169	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,193]
ZNF253	ENSG00000256771	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,194]
ZNF254	ENSG00000213096	C2H2 ZF	Known motif – High-throughput in vitro [1,195]	ACTGGCYTAGCCTCCCAGCCTACATCTTTCTCC
ZNF256	ENSG00000152454	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,196]
ZNF257	ENSG00000197134	C2H2 ZF	Known motif – High-throughput in vitro [1,197]	GAGGMRA
ZNF26	ENSG00000198393	C2H2 ZF	Known motif – In vivo/Misc source [1,198]	ATTTTT
ZNF260	ENSG00000254004	C2H2 ZF	Known motif – High-throughput in vitro [1,199]	GGARDRVDANRVDRV
ZNF263	ENSG00000006194	C2H2 ZF	Known motif – High-throughput in vitro [1,200]	GGGAGSACB
ZNF264	ENSG00000083844	C2H2 ZF	Known motif – High-throughput in vitro [1,201]	KKGRGSCCYYHNBRATGGGATTAGTGCCCT
ZNF266	ENSG00000174652	C2H2 ZF	Known motif – High-throughput in vitro [1,202]	VNHRCTCACAGSYCC
ZNF267	ENSG00000185947	C2H2 ZF	Known motif – High-throughput in vitro [1,203]	VSYNVVGGCNKGBGVRGVDG
ZNF268	ENSG00000090612	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,204]
ZNF273	ENSG00000198039	C2H2 ZF	Known motif – High-throughput in vitro [1,205]	GARAGGAGCTAC
ZNF274	ENSG00000171606	C2H2 ZF	Known motif – High-throughput in vitro [1,206]	VYGAGRACTCAYRY
ZNF275	ENSG00000063587	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,207]
ZNF276	ENSG00000158805	C2H2 ZF	Known motif – High-throughput in vitro [1,208]	WAAGGWSGWVDMKACNHCCTTWA
ZNF277	ENSG00000198839	C2H2 ZF; BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,209]
ZNF28	ENSG00000198538	C2H2 ZF	Known motif – High-throughput in vitro [1,210]	GBNKSHGGGGTGCCM
ZNF280A	ENSG00000169548	C2H2 ZF	Known motif – In vivo/Misc source [1,211]	TCTCWCCWGTRTGRRTTCTYTSAT
ZNF280B	ENSG00000275004	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,212]
ZNF280C	ENSG00000056277	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,213]
ZNF280D	ENSG00000137871	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,214]
ZNF281	ENSG00000162702	C2H2 ZF	Known motif – High-throughput in vitro [1,215]	KGGGGGAGGGGS
ZNF282	ENSG00000170265	C2H2 ZF	Known motif – High-throughput in vitro [1,216]	HTCCCMYNACMCK
ZNF283	ENSG00000167637	C2H2 ZF	Known motif – High-throughput in vitro [1,217]	BNGGCTGRTSBKGSYBGGSYB
ZNF284	ENSG00000186026	C2H2 ZF	Known motif – High-throughput in vitro [1,218]	GCTGGAGTGCAG
ZNF285	ENSG00000267508	C2H2 ZF	Known motif – In vivo/Misc source [1,219]	TNTTYTYBYTYDYTYTNHTTT
ZNF286A	ENSG00000187607	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,220]
ZNF286B	ENSG00000249459	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,221]
ZNF287	ENSG00000141040	C2H2 ZF	Known motif – High-throughput in vitro [1,222]	AAAARAAAARRWARMARAVMWRRARRAVADR
ZNF292	ENSG00000188994	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,223]
ZNF296	ENSG00000170684	C2H2 ZF	Known motif – High-throughput in vitro [1,224]	VVTGWCCASYV
ZNF3	ENSG00000166526	C2H2 ZF	Known motif – High-throughput in vitro [1,225]	TGAHTGAMTRANWGA
ZNF30	ENSG00000168661	C2H2 ZF	Known motif – High-throughput in vitro [1,226]	CGGACGGGGCGGCTG
ZNF300	ENSG00000145908	C2H2 ZF	Known motif – In vivo/Misc source [1,227]	KKDGWRDDDGNRKBNDDGDDKKNRNBKRKR
ZNF302	ENSG00000089335	C2H2 ZF	Known motif – High-throughput in vitro [1,228]	AGTTGAGTGACTGYDSTT
ZNF304	ENSG00000131845	C2H2 ZF	Known motif – High-throughput in vitro [1,229]	VVGRSYVGRBYGGGGMVGGNV
ZNF311	ENSG00000197935	C2H2 ZF	Known motif – In vivo/Misc source [1,230]	YYSCDGCBSBNBCYS
ZNF316	ENSG00000205903	C2H2 ZF	Known motif – In vivo/Misc source [1,231]	KCCSCCGGACCH
ZNF317	ENSG00000130803	C2H2 ZF	Known motif – High-throughput in vitro [1,232]	RACAGMWGACWD
ZNF318	ENSG00000171467	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,233]
ZNF319	ENSG00000166188	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,234]
ZNF32	ENSG00000169740	C2H2 ZF	Known motif – High-throughput in vitro [1,235]	BGTAAYNYGAYACB
ZNF320	ENSG00000182986	C2H2 ZF	Known motif – High-throughput in vitro [1,236]	CMYHKKCCCCYKGVHCCCMC
ZNF322	ENSG00000181315	C2H2 ZF	Known motif – High-throughput in vitro [1,237]	VVGGCHSHGKASCAGDCHS
ZNF324	ENSG00000083812	C2H2 ZF	Known motif – High-throughput in vitro [1,238]	GRTYRAACCATCCY
ZNF324B	ENSG00000249471	C2H2 ZF	Known motif – In vivo/Misc source [1,239]	HHHDGSMRGSHRAGG
ZNF326	ENSG00000162664	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,240]
ZNF329	ENSG00000181894	C2H2 ZF	Known motif – High-throughput in vitro [1,241]	CYKGAKCMVVCYNNDCCTGMA
ZNF331	ENSG00000130844	C2H2 ZF	Known motif – High-throughput in vitro [1,242]	VVAVSSNNMYWGCWGAGCMCWKYCH
ZNF333	ENSG00000160961	C2H2 ZF	Known motif – High-throughput in vitro [1,243]	STGGAKSM
ZNF334	ENSG00000198185	C2H2 ZF	Known motif – In vivo/Misc source [1,244]	YCCGKSMGGGAGGTGRGG
ZNF335	ENSG00000198026	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,245]
ZNF337	ENSG00000130684	C2H2 ZF	Known motif – High-throughput in vitro [1,246]	AGTRGTGAYRAATTC
ZNF33A	ENSG00000189180	C2H2 ZF	Known motif – High-throughput in vitro [1,247]	TCAGTGCAC
ZNF33B	ENSG00000196693	C2H2 ZF	Known motif – High-throughput in vitro [1,248]	ATTMAATHCCHTYYNHTDVMW
ZNF34	ENSG00000196378	C2H2 ZF	Known motif – In vivo/Misc source [1,249]	DRARGAVAAGYCTGD
ZNF341	ENSG00000131061	C2H2 ZF	Known motif – In vivo/Misc source [1,250]	VVVRRVRRNDVVNGGARSAGC
ZNF343	ENSG00000088876	C2H2 ZF	Known motif – High-throughput in vitro [1,251]	KRCCGHGGKGAAGCGB
ZNF345	ENSG00000251247	C2H2 ZF	Known motif – High-throughput in vitro [1,252]	TTGCAACVYVNRCAACYGKAC
ZNF346	ENSG00000113761	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,253]
ZNF347	ENSG00000197937	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,254]
ZNF35	ENSG00000169981	C2H2 ZF	Known motif – High-throughput in vitro [1,255]	ATATRTAAAGAGYTYYTABAA
ZNF350	ENSG00000256683	C2H2 ZF	Known motif – High-throughput in vitro [1,256]	DNBDVRKHAWAAAARRRCH
ZNF354A	ENSG00000169131	C2H2 ZF	Known motif – High-throughput in vitro [1,257]	RTAAATGGHYTAAAY
ZNF354B	ENSG00000178338	C2H2 ZF	Known motif – High-throughput in vitro [1,258]	AAKGRRMTAWHY
ZNF354C	ENSG00000177932	C2H2 ZF	Known motif – In vivo/Misc source [1,259]	VTCCAC
ZNF358	ENSG00000198816	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,260]
ZNF362	ENSG00000160094	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,261]
ZNF365	ENSG00000138311	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,262]
ZNF366	ENSG00000178175	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,263]
ZNF367	ENSG00000165244	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,264]
ZNF37A	ENSG00000075407	C2H2 ZF	Known motif – High-throughput in vitro [1,265]	GGARRRRRV
ZNF382	ENSG00000161298	C2H2 ZF	Known motif – High-throughput in vitro [1,266]	GWGVMANYASTACAGRYMHHRBDS
ZNF383	ENSG00000188283	C2H2 ZF	Known motif – High-throughput in vitro [1,267]	GAGSVRVRASRKGGMAGGRRBCNGGGY
ZNF384	ENSG00000126746	C2H2 ZF	Known motif – High-throughput in vitro [1,268]	TTTTBNNNNNNNNNNNNVAAAA
ZNF385A	ENSG00000161642	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,269]
ZNF385B	ENSG00000144331	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,270]
ZNF385C	ENSG00000187595	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,271]
ZNF385D	ENSG00000151789	C2H2 ZF	Known motif – High-throughput in vitro [1,272]	HHGTCGCGACRD
ZNF391	ENSG00000124613	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,273]
ZNF394	ENSG00000160908	C2H2 ZF	Known motif – In vivo/Misc source [1,274]	VVRGGAGNAGCWGNRVVDNV
ZNF395	ENSG00000186918	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,275]
ZNF396	ENSG00000186496	C2H2 ZF	Known motif – High-throughput in vitro [1,276]	VTTTCGKACAB
ZNF397	ENSG00000186812	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,277]
ZNF398	ENSG00000197024	C2H2 ZF	Known motif – In vivo/Misc source [1,278]	DGGGARRGARRSAG
ZNF404	ENSG00000176222	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,279]
ZNF407	ENSG00000215421	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,280]
ZNF408	ENSG00000175213	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,281]
ZNF41	ENSG00000147124	C2H2 ZF	Known motif – High-throughput in vitro [1,282]	RMARGGRARNNNRRSACMATGAGNVAV
ZNF410	ENSG00000119725	C2H2 ZF	Known motif – High-throughput in vitro [1,283]	MCATCCCATAATANBM
ZNF414	ENSG00000133250	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,284]
ZNF415	ENSG00000170954	C2H2 ZF	Known motif – In vivo/Misc source [1,285]	VTRCVCVMTKARBATC
ZNF416	ENSG00000083817	C2H2 ZF	Known motif – In vivo/Misc source [1,286]	TRGCCCAGTCAAGTTGAC
ZNF417	ENSG00000173480	C2H2 ZF	Known motif – High-throughput in vitro [1,287]	HNGGCGCCAVNTG
ZNF418	ENSG00000196724	C2H2 ZF	Known motif – High-throughput in vitro [1,288]	VDGWRGCYAAAAGCA
ZNF419	ENSG00000105136	C2H2 ZF	Known motif – High-throughput in vitro [1,289]	DGGARAGKMHAGGRCTGBADW
ZNF420	ENSG00000197050	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,290]
ZNF423	ENSG00000102935	C2H2 ZF	Known motif – In vivo/Misc source [1,291]	GRCACCCWAGGGTGC
ZNF425	ENSG00000204947	C2H2 ZF	Known motif – In vivo/Misc source [1,292]	GGBACA
ZNF426	ENSG00000130818	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,293]
ZNF428	ENSG00000131116	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,294]
ZNF429	ENSG00000197013	C2H2 ZF	Known motif – High-throughput in vitro [1,295]	DGGMRKAGSHVNMAATGGGYH
ZNF43	ENSG00000198521	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,296]
ZNF430	ENSG00000118620	C2H2 ZF	Known motif – High-throughput in vitro [1,297]	MCADGGHRGMNDGCHR
ZNF431	ENSG00000196705	C2H2 ZF	Known motif – In vivo/Misc source [1,298]	VRGGCTRGMWGNYNV
ZNF432	ENSG00000256087	C2H2 ZF	Known motif – In vivo/Misc source [1,299]	GTYRAAAACAAT
ZNF433	ENSG00000197647	C2H2 ZF	Known motif – High-throughput in vitro [1,300]	RDGACYRHWGTRRTAAYY
ZNF436	ENSG00000125945	C2H2 ZF	Known motif – High-throughput in vitro [1,301]	TCCTCCAGGAAGCCY
ZNF438	ENSG00000183621	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,302]
ZNF439	ENSG00000171291	C2H2 ZF	Known motif – In vivo/Misc source [1,303]	CARTCACCYYCHGGV
ZNF44	ENSG00000197857	C2H2 ZF	Known motif – High-throughput in vitro [1,304]	VBGNTVYKGCHGYDVNG
ZNF440	ENSG00000171295	C2H2 ZF	Known motif – High-throughput in vitro [1,305]	RRTKGTTCTGCW
ZNF441	ENSG00000197044	C2H2 ZF	Known motif – High-throughput in vitro [1,306]	SRGRCGGAGYB
ZNF442	ENSG00000198342	C2H2 ZF	Known motif – In vivo/Misc source [1,307]	SHWDWTWTTTNHHTTTTT
ZNF443	ENSG00000180855	C2H2 ZF	Known motif – High-throughput in vitro [1,308]	GYCTBCYMAGWHGCKGGBRTT
ZNF444	ENSG00000167685	C2H2 ZF	Known motif – High-throughput in vitro [1,309]	DGGGGGAGGGGGAYG
ZNF445	ENSG00000185219	C2H2 ZF	Known motif – In vivo/Misc source [1,310]	AAMTYCYYGASNRNMMAGGRKTMYYYCHC
ZNF446	ENSG00000083838	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,311]
ZNF449	ENSG00000173275	C2H2 ZF	Known motif – High-throughput in vitro [1,312]	RCGCCCAACC
ZNF45	ENSG00000124459	C2H2 ZF	Known motif – High-throughput in vitro [1,313]	AGGAANAYA
ZNF451	ENSG00000112200	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,314]
ZNF454	ENSG00000178187	C2H2 ZF	Known motif – High-throughput in vitro [1,315]	WRGCGCCWGGCGCYW
ZNF460	ENSG00000197714	C2H2 ZF	Known motif – High-throughput in vitro [1,316]	CAACGCCCCCCG
ZNF461	ENSG00000197808	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,317]
ZNF462	ENSG00000148143	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,318]
ZNF467	ENSG00000181444	C2H2 ZF	Known motif – High-throughput in vitro [1,319]	GGDGGGGGAGGG
ZNF468	ENSG00000204604	C2H2 ZF	Known motif – High-throughput in vitro [1,320]	DGGGAGGGGGYGSNS
ZNF469	ENSG00000225614	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,321]
ZNF470	ENSG00000197016	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,322]
ZNF471	ENSG00000196263	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,323]
ZNF473	ENSG00000142528	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,324]
ZNF474	ENSG00000164185	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,325]
ZNF479	ENSG00000185177	C2H2 ZF	Known motif – High-throughput in vitro [1,326]	GADGACYYKGRGGRY
ZNF48	ENSG00000180035	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,327]
ZNF480	ENSG00000198464	C2H2 ZF	Known motif – High-throughput in vitro [1,328]	DRDGAAKGDGDD
ZNF483	ENSG00000173258	C2H2 ZF	Known motif – High-throughput in vitro [1,329]	DSAGRGAGCTGCA
ZNF484	ENSG00000127081	C2H2 ZF	Known motif – High-throughput in vitro [1,330]	VRDGGAVWGVRGMASWDGVNV
ZNF485	ENSG00000198298	C2H2 ZF	Known motif – High-throughput in vitro [1,331]	AYTTSSWWTKKSRMYRTRKGS
ZNF486	ENSG00000256229	C2H2 ZF	Known motif – In vivo/Misc source [1,332]	VVBBBNSNGCSGAMDCCCGGV
ZNF487	ENSG00000243660	C2H2 ZF	Known motif – In vivo/Misc source [1,333]	VVBBBNSNGCSGAMDCCCGGV
ZNF488	ENSG00000265763	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,334]
ZNF490	ENSG00000188033	C2H2 ZF	Known motif – In vivo/Misc source [1,335]	HDGNMRGCAGCANAY
ZNF491	ENSG00000177599	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,336]
ZNF492	ENSG00000229676	C2H2 ZF	Known motif – High-throughput in vitro [1,337]	MNAARARMAMBAAAARGG
ZNF493	ENSG00000196268	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,338]
ZNF496	ENSG00000162714	C2H2 ZF	Known motif – In vivo/Misc source [1,339]	BCNSBCYCYBHMYYHSHBYCY
ZNF497	ENSG00000174586	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,340]
ZNF500	ENSG00000103199	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,341]
ZNF501	ENSG00000186446	C2H2 ZF	Known motif – High-throughput in vitro [1,342]	GCGACGCGAMCV
ZNF502	ENSG00000196653	C2H2 ZF	Known motif – High-throughput in vitro [1,343]	GGACYDBTGCAGTAGYHH
ZNF503	ENSG00000165655	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,344]
ZNF506	ENSG00000081665	C2H2 ZF	Known motif – High-throughput in vitro [1,345]	YTGGGGGCTCVBMC
ZNF507	ENSG00000168813	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,346]
ZNF510	ENSG00000081386	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,347]
ZNF511	ENSG00000198546	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,348]
ZNF512	ENSG00000243943	C2H2 ZF; BED ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,349]
ZNF512B	ENSG00000196700	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,350]
ZNF513	ENSG00000163795	C2H2 ZF	Known motif – High-throughput in vitro [1,351]	GATGRTGATGATGRT
ZNF514	ENSG00000144026	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,352]
ZNF516	ENSG00000101493	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,353]
ZNF517	ENSG00000197363	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,354]
ZNF518A	ENSG00000177853	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,355]
ZNF518B	ENSG00000178163	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,356]
ZNF519	ENSG00000175322	C2H2 ZF	Known motif – High-throughput in vitro [1,357]	GGGCGGCKGCRGCBGCGS
ZNF521	ENSG00000198795	C2H2 ZF	Known motif – In vivo/Misc source [1,358]	TGGGGGMCCCCW
ZNF524	ENSG00000171443	C2H2 ZF; AT hook	Known motif – High-throughput in vitro [1,359]	YTCGVACCC
ZNF525	ENSG00000203326	C2H2 ZF	Known motif – High-throughput in vitro [1,360]	RTTMCTWATDMAGNT
ZNF526	ENSG00000167625	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,361]
ZNF527	ENSG00000189164	C2H2 ZF	Known motif – In vivo/Misc source [1,362]	DGRKNGBMDGHRACAGMRR
ZNF528	ENSG00000167555	C2H2 ZF	Known motif – High-throughput in vitro [1,363]	GGAAGYCATTTC
ZNF529	ENSG00000186020	C2H2 ZF	Known motif – In vivo/Misc source [1,364]	CYCYBYCTBCYHDSM
ZNF530	ENSG00000183647	C2H2 ZF	Known motif – High-throughput in vitro [1,365]	GMADGGMNAGGGSCNGVV
ZNF532	ENSG00000074657	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,366]
ZNF534	ENSG00000198633	C2H2 ZF	Known motif – High-throughput in vitro [1,367]	GVGGGGMRAGARBNBVV
ZNF536	ENSG00000198597	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,368]
ZNF540	ENSG00000171817	C2H2 ZF	Known motif – In vivo/Misc source [1,369]	RGRGGVAGGVA
ZNF541	ENSG00000118156	C2H2 ZF; Myb/SANT	Known motif – In vivo/Misc source [1,370]	CCCATGCGCGGG
ZNF543	ENSG00000178229	C2H2 ZF	Known motif – High-throughput in vitro [1,371]	SSVCWGGVCMGS
ZNF544	ENSG00000198131	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,372]
ZNF546	ENSG00000187187	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,373]
ZNF547	ENSG00000152433	C2H2 ZF	Known motif – High-throughput in vitro [1,374]	GCWAAYKCWGCARGC
ZNF548	ENSG00000188785	C2H2 ZF	Known motif – High-throughput in vitro [1,375]	GBBGCKGCDGSVSSVSVG
ZNF549	ENSG00000121406	C2H2 ZF	Known motif – High-throughput in vitro [1,376]	ATGAAYYGGGCAGCM
ZNF550	ENSG00000251369	C2H2 ZF	Known motif – High-throughput in vitro [1,377]	DNVRRDGCWRRGGYAGRG
ZNF551	ENSG00000204519	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,378]
ZNF552	ENSG00000178935	C2H2 ZF	Known motif – High-throughput in vitro [1,379]	CCACGAGGGGH
ZNF554	ENSG00000172006	C2H2 ZF	Known motif – High-throughput in vitro [1,380]	CHGRGYCANNYRGDKDRCH
ZNF555	ENSG00000186300	C2H2 ZF	Known motif – In vivo/Misc source [1,381]	AAAAAGCCGCGGCGG
ZNF556	ENSG00000172000	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,382]
ZNF557	ENSG00000130544	C2H2 ZF	Known motif – In vivo/Misc source [1,383]	MAGARTGYT
ZNF558	ENSG00000167785	C2H2 ZF	Known motif – High-throughput in vitro [1,384]	HKGRAYHTGTRGRTKBATRYCTTYCAK
ZNF559	ENSG00000188321	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,385]
ZNF560	ENSG00000198028	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,386]
ZNF561	ENSG00000171469	C2H2 ZF	Known motif – In vivo/Misc source [1,387]	DSNGCMGAAARGSBBYBBBCC
ZNF562	ENSG00000171466	C2H2 ZF	Known motif – In vivo/Misc source [1,388]	DDYYCAGCAAGGCAMWWT
ZNF563	ENSG00000188868	C2H2 ZF	Known motif – High-throughput in vitro [1,389]	BTCMBNNSHRGCMRCHGY
ZNF564	ENSG00000249709	C2H2 ZF	Known motif – High-throughput in vitro [1,390]	GGGAAGTCCAAG
ZNF565	ENSG00000196357	C2H2 ZF	Known motif – High-throughput in vitro [1,391]	ATGYTGTGAGGAAGCYCA
ZNF566	ENSG00000186017	C2H2 ZF	Known motif – High-throughput in vitro [1,392]	VNDGCKGVAARGGARSC
ZNF567	ENSG00000189042	C2H2 ZF	Known motif – High-throughput in vitro [1,393]	VHAVAARHAGAMMHHNARRTG
ZNF568	ENSG00000198453	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,394]
ZNF569	ENSG00000196437	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,395]
ZNF57	ENSG00000171970	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,396]
ZNF570	ENSG00000171827	C2H2 ZF	Known motif – High-throughput in vitro [1,397]	ARAHAWMWHNMAAGAAAA
ZNF571	ENSG00000180479	C2H2 ZF	Known motif – High-throughput in vitro [1,398]	SSGMGGCBGMGGCRG
ZNF572	ENSG00000180938	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,399]
ZNF573	ENSG00000189144	C2H2 ZF	Known motif – High-throughput in vitro [1,400]	MAGHMMDGGCMCAMNMADB
ZNF574	ENSG00000105732	C2H2 ZF	Known motif – High-throughput in vitro [1,401]	CTAGAGMGKCSS
ZNF575	ENSG00000176472	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,402]
ZNF576	ENSG00000124444	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,403]
ZNF577	ENSG00000161551	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,404]
ZNF578	ENSG00000258405	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,405]
ZNF579	ENSG00000218891	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,406]
ZNF580	ENSG00000213015	C2H2 ZF	Known motif – High-throughput in vitro [1,407]	VCTACCNYHNNVCTACCNH
ZNF581	ENSG00000171425	C2H2 ZF	Known motif – In vivo/Misc source [1,408]	CTTCTAVAAGV
ZNF582	ENSG00000018869	C2H2 ZF	Known motif – High-throughput in vitro [1,409]	KYMSYTGCMGCCNARNGCAYBCYH
ZNF583	ENSG00000198440	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,410]
ZNF584	ENSG00000171574	C2H2 ZF	Known motif – High-throughput in vitro [1,411]	DNTTTMARAAHTGYTWTGGDH
ZNF585A	ENSG00000196967	C2H2 ZF	Known motif – High-throughput in vitro [1,412]	TCYGTWYTY
ZNF585B	ENSG00000245680	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,413]
ZNF586	ENSG00000083828	C2H2 ZF	Known motif – High-throughput in vitro [1,414]	CAGGCCYRGAGG
ZNF587	ENSG00000198466	C2H2 ZF	Known motif – High-throughput in vitro [1,415]	MCMRYGTTGGGCGCHANNHD
ZNF587B	ENSG00000269343	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,416]
ZNF589	ENSG00000164048	C2H2 ZF	Known motif – In vivo/Misc source [1,417]	VSRBDRWWVCCBYKK
ZNF592	ENSG00000166716	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,418]
ZNF594	ENSG00000180626	C2H2 ZF	Known motif – High-throughput in vitro [1,419]	RDDSDGAGAGCNSS
ZNF595	ENSG00000272602	C2H2 ZF	Known motif – High-throughput in vitro [1,420]	GGGAGGGMWKC
ZNF596	ENSG00000172748	C2H2 ZF	Known motif – High-throughput in vitro [1,421]	VGVRRGAGVSMGAGM
ZNF597	ENSG00000167981	C2H2 ZF	Known motif – High-throughput in vitro [1,422]	CAARATGGCGKM
ZNF598	ENSG00000167962	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,423]
ZNF599	ENSG00000153896	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,424]
ZNF600	ENSG00000189190	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,425]
ZNF605	ENSG00000196458	C2H2 ZF	Known motif – High-throughput in vitro [1,426]	DGGKNNDDAGRVVCCMNRVD
ZNF606	ENSG00000166704	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,427]
ZNF607	ENSG00000198182	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,428]
ZNF608	ENSG00000168916	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,429]
ZNF609	ENSG00000180357	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,430]
ZNF610	ENSG00000167554	C2H2 ZF	Known motif – High-throughput in vitro [1,431]	GGAGCGGC
ZNF611	ENSG00000213020	C2H2 ZF	Known motif – High-throughput in vitro [1,432]	GGAGMGCCBVNGVVBVSCBSB
ZNF613	ENSG00000176024	C2H2 ZF	Known motif – High-throughput in vitro [1,433]	WAAAAAAAB
ZNF614	ENSG00000142556	C2H2 ZF	Known motif – In vivo/Misc source [1,434]	BDCTTKAKCTMATKD
ZNF615	ENSG00000197619	C2H2 ZF	Known motif – High-throughput in vitro [1,435]	AAABDVCTGYBSCCC
ZNF616	ENSG00000204611	C2H2 ZF	Known motif – High-throughput in vitro [1,436]	RHRGGTGAGCRY
ZNF618	ENSG00000157657	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,437]
ZNF619	ENSG00000177873	C2H2 ZF	Known motif – In vivo/Misc source [1,438]	BYNNBCCCCNNCCYCAGGAAT
ZNF620	ENSG00000177842	C2H2 ZF	Known motif – In vivo/Misc source [1,439]	WKTSYAKTY
ZNF621	ENSG00000172888	C2H2 ZF	Known motif – In vivo/Misc source [1,440]	RRRVKCYCAGGGMAG
ZNF623	ENSG00000183309	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,441]
ZNF624	ENSG00000197566	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,442]
ZNF625	ENSG00000257591	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,443]
ZNF626	ENSG00000188171	C2H2 ZF	Known motif – High-throughput in vitro [1,444]	HDVRTNNKGYTVHKVTGBYCCYTSYH
ZNF627	ENSG00000198551	C2H2 ZF	Known motif – High-throughput in vitro [1,445]	TTTAAGCCCACTGTTGAG
ZNF628	ENSG00000197483	C2H2 ZF	Known motif – In vivo/Misc source [1,446]	GCAACCAACCTTG
ZNF629	ENSG00000102870	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,447]
ZNF630	ENSG00000221994	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,448]
ZNF639	ENSG00000121864	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,449]
ZNF641	ENSG00000167528	C2H2 ZF	Known motif – High-throughput in vitro [1,450]	TGGGGGGGT
ZNF644	ENSG00000122482	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,451]
ZNF645	ENSG00000175809	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,452]
ZNF646	ENSG00000167395	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,453]
ZNF648	ENSG00000179930	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,454]
ZNF649	ENSG00000198093	C2H2 ZF	Known motif – High-throughput in vitro [1,455]	ATATAA
ZNF652	ENSG00000198740	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,456]
ZNF653	ENSG00000161914	C2H2 ZF; AT hook	Known motif – In vivo/Misc source [1,457]	WTTHNYDHCYKCCGACWNHWAWD
ZNF654	ENSG00000175105	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,458]
ZNF655	ENSG00000197343	C2H2 ZF	Known motif – High-throughput in vitro [1,459]	RVTAH
ZNF658	ENSG00000274349	C2H2 ZF	Known motif – In vivo/Misc source [1,460]	GGGGTRGGACGAGGTGGG
ZNF66	ENSG00000160229	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,461]
ZNF660	ENSG00000144792	C2H2 ZF	Known motif – High-throughput in vitro [1,462]	DYAGGDTGGRBHATCADB
ZNF662	ENSG00000182983	C2H2 ZF	Known motif – High-throughput in vitro [1,463]	DRNAGSMVVGKGMYAGMB
ZNF664	ENSG00000179195	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,464]	GTTBAAWMCGC
ZNF665	ENSG00000197497	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,465]
ZNF667	ENSG00000198046	C2H2 ZF	Known motif – High-throughput in vitro [1,466]	GCYTTAARAGCTCANCH
ZNF668	ENSG00000167394	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,467]
ZNF669	ENSG00000188295	C2H2 ZF	Known motif – High-throughput in vitro [1,468]	VNHHRSANYGGTCRTCRNCCH
ZNF670	ENSG00000277462	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,469]
ZNF671	ENSG00000083814	C2H2 ZF	Known motif – High-throughput in vitro [1,470]	GAKTGGADBRV
ZNF672	ENSG00000171161	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,471]
ZNF674	ENSG00000251192	C2H2 ZF	Known motif – High-throughput in vitro [1,472]	GGRBCVCCRVV
ZNF675	ENSG00000197372	C2H2 ZF	Known motif – High-throughput in vitro [1,473]	RKGVNHNRGRGGMYAAAAYGD
ZNF676	ENSG00000196109	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,474]
ZNF677	ENSG00000197928	C2H2 ZF	Known motif – High-throughput in vitro [1,475]	GRAMMCHRAHAAGAWCAGHH
ZNF678	ENSG00000181450	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,476]
ZNF679	ENSG00000197123	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,477]	DGGCAGCAGM
ZNF680	ENSG00000173041	C2H2 ZF	Known motif – High-throughput in vitro [1,478]	HNNNNDGNCMAAGAAGAHTNW
ZNF681	ENSG00000196172	C2H2 ZF	Known motif – High-throughput in vitro [1,479]	VAAGGABGVNGR
ZNF682	ENSG00000197124	C2H2 ZF	Known motif – High-throughput in vitro [1,480]	DDHYMAGCCC
ZNF683	ENSG00000176083	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,481]
ZNF684	ENSG00000117010	C2H2 ZF	Known motif – High-throughput in vitro [1,482]	BACAGTCCACCCCTTDV
ZNF687	ENSG00000143373	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,483]
ZNF688	ENSG00000229809	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,484]
ZNF689	ENSG00000156853	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,485]
ZNF69	ENSG00000198429	C2H2 ZF	Known motif – In vivo/Misc source [1,486]	GGRGSHGGGGBDGGV
ZNF691	ENSG00000164011	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,487]	RKGAGYAC
ZNF692	ENSG00000171163	C2H2 ZF	Known motif – In vivo/Misc source [1,488]	SBGGGVCCCACH
ZNF695	ENSG00000197472	C2H2 ZF	Known motif – In vivo/Misc source [1,489]	ACCAMMHMC
ZNF696	ENSG00000185730	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,490]
ZNF697	ENSG00000143067	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,491]	KKKGCGAGGGM
ZNF699	ENSG00000196110	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,492]
ZNF7	ENSG00000147789	C2H2 ZF	Known motif – High-throughput in vitro [1,493]	VWRRMADYWNYAARWGBWGRC
ZNF70	ENSG00000187792	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,494]
ZNF700	ENSG00000196757	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,495]
ZNF701	ENSG00000167562	C2H2 ZF	Known motif – High-throughput in vitro [1,496]	GAGMASYHDRGG
ZNF703	ENSG00000183779	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,497]
ZNF704	ENSG00000164684	C2H2 ZF	Known motif – High-throughput in vitro [1,498]	HRCCGGCCGGYD
ZNF705A	ENSG00000196946	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,499]	CCAAAARAAYY
ZNF705B	ENSG00000215356	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,500]	CCAAAARAAYY
ZNF705D	ENSG00000215343	C2H2 ZF	Inferred motif from similar protein – In vivo/Misc source [1,501]	CCAAAARAAYY
ZNF705E	ENSG00000214534	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,502]
ZNF705G	ENSG00000215372	C2H2 ZF	Known motif – In vivo/Misc source [1,503]	RAKAAACCTCY
ZNF706	ENSG00000120963	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,504]
ZNF707	ENSG00000181135	C2H2 ZF	Known motif – High-throughput in vitro [1,505]	DACMAGGAGTGGGGTK
ZNF708	ENSG00000182141	C2H2 ZF	Known motif – High-throughput in vitro [1,506]	RDDAGGYACAGCH
ZNF709	ENSG00000242852	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,507]
ZNF71	ENSG00000197951	C2H2 ZF	Known motif – High-throughput in vitro [1,508]	BRGNRGSMRRRGVRARRARRGMAA
ZNF710	ENSG00000140548	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,509]
ZNF711	ENSG00000147180	C2H2 ZF	Known motif – In vivo/Misc source [1,510]	MGGCCTVS
ZNF713	ENSG00000178665	C2H2 ZF	Known motif – High-throughput in vitro [1,511]	WAGAMRAAWGCCACGAA
ZNF714	ENSG00000160352	C2H2 ZF	Known motif – High-throughput in vitro [1,512]	DKMRKTSCTGCT
ZNF716	ENSG00000182111	C2H2 ZF	Known motif – High-throughput in vitro [1,513]	VTATTTCY
ZNF717	ENSG00000227124	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,514]
ZNF718	ENSG00000250312	C2H2 ZF	Known motif – In vivo/Misc source [1,515]	GGGRATWGCGM
ZNF721	ENSG00000182903	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,516]
ZNF724	ENSG00000196081	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,517]
ZNF726	ENSG00000213967	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,518]
ZNF727	ENSG00000214652	C2H2 ZF	Known motif – In vivo/Misc source [1,519]	GGTCCAAWTGM
ZNF728	ENSG00000269067	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,520]
ZNF729	ENSG00000196350	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,521]
ZNF730	ENSG00000183850	C2H2 ZF	Known motif – High-throughput in vitro [1,522]	GGGMRGSBRNGG
ZNF732	ENSG00000186777	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,523]
ZNF735	ENSG00000223614	C2H2 ZF	Known motif – In vivo/Misc source [1,524]	DGGCAGCAGM
ZNF736	ENSG00000234444	C2H2 ZF	Known motif – High-throughput in vitro [1,525]	YCYRGGGYTTTT
ZNF737	ENSG00000237440	C2H2 ZF	Known motif – In vivo/Misc source [1,526]	RKRVDGRDGVWGGDG
ZNF74	ENSG00000185252	C2H2 ZF	Known motif – In vivo/Misc source [1,527]	RAAGATGTTCHYYDCVKYRTTRTTTAHVW
ZNF740	ENSG00000139651	C2H2 ZF	Known motif – High-throughput in vitro [1,528]	YNCCCCCCCCAC
ZNF746	ENSG00000181220	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,529]
ZNF747	ENSG00000169955	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,530]
ZNF749	ENSG00000186230	C2H2 ZF	Known motif – High-throughput in vitro [1,531]	GYTGGGGYT
ZNF750	ENSG00000141579	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,532]
ZNF75A	ENSG00000162086	C2H2 ZF	Known motif – High-throughput in vitro [1,533]	TGTGGGAAAASM
ZNF75D	ENSG00000186376	C2H2 ZF	Known motif – High-throughput in vitro [1,534]	GTGGGAAAKCCTTYH
ZNF76	ENSG00000065029	C2H2 ZF	Known motif – High-throughput in vitro [1,535]	HWCCCABAATGCAHYRCR
ZNF761	ENSG00000160336	C2H2 ZF	Known motif – In vivo/Misc source [1,536]	KGDWAATCAKA
ZNF763	ENSG00000197054	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,537]
ZNF764	ENSG00000169951	C2H2 ZF	Known motif – In vivo/Misc source [1,538]	TGCARCCYAGCTCTAYDAGMC
ZNF765	ENSG00000196417	C2H2 ZF	Known motif – High-throughput in vitro [1,539]	CTBGGCHVNGCMCWGVS
ZNF766	ENSG00000196214	C2H2 ZF	Known motif – In vivo/Misc source [1,540]	RAKAAACCYYH
ZNF768	ENSG00000169957	C2H2 ZF	Known motif – High-throughput in vitro [1,541]	CHCAGAGAGGKYRAG
ZNF77	ENSG00000175691	C2H2 ZF	Known motif – In vivo/Misc source [1,542]	TYMYCACTYCACYHNNNHMAD
ZNF770	ENSG00000198146	C2H2 ZF	Known motif – In vivo/Misc source [1,543]	GGAGGCYGVVV
ZNF771	ENSG00000179965	C2H2 ZF	Known motif – High-throughput in vitro [1,544]	RCGCTAACCAYTD
ZNF772	ENSG00000197128	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,545]
ZNF773	ENSG00000152439	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,546]
ZNF774	ENSG00000196391	C2H2 ZF	Known motif – High-throughput in vitro [1,547]	DGRRRVRGAGVHDGRRD
ZNF775	ENSG00000196456	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,548]
ZNF776	ENSG00000152443	C2H2 ZF	Known motif – High-throughput in vitro [1,549]	GAAGCAHRRYGCYGGCATCTG
ZNF777	ENSG00000196453	C2H2 ZF	Known motif – In vivo/Misc source [1,550]	GHCCSYCCCGTCSARCAAW
ZNF778	ENSG00000170100	C2H2 ZF	Known motif – High-throughput in vitro [1,551]	CAGACRMCRRCH
ZNF780A	ENSG00000197782	C2H2 ZF	Known motif – High-throughput in vitro [1,552]	VNNNNDNNHDGGCAGGYNBNYDDV
ZNF780B	ENSG00000128000	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,553]
ZNF781	ENSG00000196381	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,554]
ZNF782	ENSG00000196597	C2H2 ZF	Known motif – In vivo/Misc source [1,555]	HARRHCCWACAHVDRGRSHNYCTCAVRVVY
ZNF783	ENSG00000204946	C2H2 ZF	Known motif – In vivo/Misc source [1,556]	SBTSCWSCDSCDSYDSCWGCT
ZNF784	ENSG00000179922	C2H2 ZF	Known motif – High-throughput in vitro [1,557]	ACYTWCCK
ZNF785	ENSG00000197162	C2H2 ZF	Known motif – In vivo/Misc source [1,558]	ACWBRBRCAYACASWYVMMCVMACACASA
ZNF786	ENSG00000197362	C2H2 ZF	Known motif – In vivo/Misc source [1,559]	CRGRGNCCCRRRGRC
ZNF787	ENSG00000142409	C2H2 ZF	Known motif – High-throughput in vitro [1,560]	BGAGGCANNNNNNNTGCATY
ZNF788	ENSG00000214189	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,561]
ZNF789	ENSG00000198556	C2H2 ZF	Known motif – High-throughput in vitro [1,562]	CYYSTGACACCH
ZNF79	ENSG00000196152	C2H2 ZF	Known motif – High-throughput in vitro [1,563]	AAAVRAAWDAATNTCTAA
ZNF790	ENSG00000197863	C2H2 ZF	Known motif – High-throughput in vitro [1,564]	GTGCAGCA
ZNF791	ENSG00000173875	C2H2 ZF	Known motif – In vivo/Misc source [1,565]	CKCTGACCCCDCCTCCYBTCTAAA
ZNF792	ENSG00000180884	C2H2 ZF	Known motif – In vivo/Misc source [1,566]	DRCTGDTKWNHDBAGATAGKR
ZNF793	ENSG00000188227	C2H2 ZF	Known motif – High-throughput in vitro [1,567]	GARCCCCAAGVV
ZNF799	ENSG00000196466	C2H2 ZF	Known motif – High-throughput in vitro [1,568]	AYMCYBGYTGTCTCAGTGWTTKGS
ZNF8	ENSG00000278129	C2H2 ZF	Known motif – High-throughput in vitro [1,569]	DHNDDGRCRTACCRBV
ZNF80	ENSG00000174255	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,570]
ZNF800	ENSG00000048405	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,571]
ZNF804A	ENSG00000170396	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,572]
ZNF804B	ENSG00000182348	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,573]
ZNF805	ENSG00000204524	C2H2 ZF	Known motif – High-throughput in vitro [1,574]	MYKSCATTCCWTKSCWTKYSR
ZNF808	ENSG00000198482	C2H2 ZF	Known motif – High-throughput in vitro [1,575]	GGNWGGWCTVYAAAVNVSHYKBTHNDKND
ZNF81	ENSG00000197779	C2H2 ZF	Known motif – High-throughput in vitro [1,576]	TGGTVNHACYABYNNRRA
ZNF813	ENSG00000198346	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,577]
ZNF814	ENSG00000204514	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,578]
ZNF816	ENSG00000180257	C2H2 ZF	Known motif – High-throughput in vitro [1,579]	VVNNRDGGGGACMKGHND
ZNF821	ENSG00000102984	C2H2 ZF	Known motif – High-throughput in vitro [1,580]	HRGACAGACVGACR
ZNF823	ENSG00000197933	C2H2 ZF	Known motif – High-throughput in vitro [1,581]	HHYTTCTCYNYYBCY
ZNF827	ENSG00000151612	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,582]
ZNF829	ENSG00000185869	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,583]
ZNF83	ENSG00000167766	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,584]
ZNF830	ENSG00000198783	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,585]
ZNF831	ENSG00000124203	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,586]
ZNF835	ENSG00000127903	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,587]
ZNF836	ENSG00000196267	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,588]
ZNF837	ENSG00000152475	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,589]
ZNF84	ENSG00000198040	C2H2 ZF	Known motif – High-throughput in vitro [1,590]	RVRRVNNVNRDGAACAGGMAR
ZNF841	ENSG00000197608	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,591]
ZNF843	ENSG00000176723	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,592]
ZNF844	ENSG00000223547	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,593]
ZNF845	ENSG00000213799	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,594]
ZNF846	ENSG00000196605	C2H2 ZF	Known motif – In vivo/Misc source [1,595]	GVGSMVGGGMSVSVG
ZNF85	ENSG00000105750	C2H2 ZF	Known motif – High-throughput in vitro [1,596]	BRGATTMCWKCA
ZNF850	ENSG00000267041	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,597]
ZNF852	ENSG00000178917	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,598]	VYAHACTKTNRAGYGV
ZNF853	ENSG00000236609	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,599]
ZNF860	ENSG00000197385	C2H2 ZF	Known motif – High-throughput in vitro [1,600]	VRCAGGGAGCVRVVS
ZNF865	ENSG00000261221	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,601]
ZNF878	ENSG00000257446	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,602]
ZNF879	ENSG00000234284	C2H2 ZF	Known motif – High-throughput in vitro [1,603]	AHARHAMWAHWRAAMMWANWWRVH
ZNF880	ENSG00000221923	C2H2 ZF	Known motif – High-throughput in vitro [1,604]	DDNDDVDNGGGRRDGGGARAGDGMAR
ZNF883	ENSG00000228623	C2H2 ZF	Known motif – In vivo/Misc source [1,605]	GAGGCAGCCACH
ZNF888	ENSG00000213793	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,606]
ZNF891	ENSG00000214029	C2H2 ZF	Known motif – High-throughput in vitro [1,607]	BNNNNSNGRCWKCYAGCC
ZNF90	ENSG00000213988	C2H2 ZF	Known motif – High-throughput in vitro [1,608]	TGGGTGDRTMAKCAG
ZNF91	ENSG00000167232	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,609]
ZNF92	ENSG00000146757	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,610]
ZNF93	ENSG00000184635	C2H2 ZF	Known motif – High-throughput in vitro [1,611]	BNNNBNHNGCWGCHRBSNYWGCTRCYDYC
ZNF98	ENSG00000197360	C2H2 ZF	Known motif – High-throughput in vitro [1,612]	VNADRKMCAANAAAAAGGHM
ZNF99	ENSG00000213973	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,613]
ZSCAN1	ENSG00000152467	C2H2 ZF	Known motif – High-throughput in vitro [1,614]	HRCACACVCTGHMAVH
ZSCAN10	ENSG00000130182	C2H2 ZF	Inferred motif from similar protein – High-throughput in vitro [1,615]	GDRAGTGC
ZSCAN12	ENSG00000158691	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,616]
ZSCAN16	ENSG00000196812	C2H2 ZF	Known motif – High-throughput in vitro [1,617]	GAGGCTCTGTTAACANY
ZSCAN18	ENSG00000121413	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,618]
ZSCAN2	ENSG00000176371	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,619]
ZSCAN20	ENSG00000121903	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,620]
ZSCAN21	ENSG00000166529	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,621]
ZSCAN22	ENSG00000182318	C2H2 ZF	Known motif – High-throughput in vitro [1,622]	GNCHGABGGMGGAGGCNV
ZSCAN23	ENSG00000187987	C2H2 ZF	Known motif – High-throughput in vitro [1,623]	BTGTAATTAGCACATGR
ZSCAN25	ENSG00000197037	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,624]
ZSCAN26	ENSG00000197062	C2H2 ZF	Known motif – In vivo/Misc source [1,625]	TGGGGGGCATM
ZSCAN29	ENSG00000140265	C2H2 ZF	Known motif – High-throughput in vitro [1,626]	MCGYRTARMCGKCTAYRC
ZSCAN30	ENSG00000186814	C2H2 ZF	Known motif – High-throughput in vitro [1,627]	BCCWGSRGCCHBSVS
ZSCAN31	ENSG00000235109	C2H2 ZF	Known motif – High-throughput in vitro [1,628]	GHHGCAGGGCARTTATGC
ZSCAN32	ENSG00000140987	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,629]
ZSCAN4	ENSG00000180532	C2H2 ZF	Known motif – High-throughput in vitro [1,630]	HGCACACVCTGNMA
ZSCAN5A	ENSG00000131848	C2H2 ZF	Known motif – High-throughput in vitro [1,631]	HKTCCCYVCVCAAADM
ZSCAN5B	ENSG00000197213	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,632]
ZSCAN5C	ENSG00000204532	C2H2 ZF	Known motif – High-throughput in vitro [1,633]	GTGAGTNHAYRRRNV
ZSCAN9	ENSG00000137185	C2H2 ZF	Known motif – High-throughput in vitro [1,634]	DRKGATAAGATAAGAABCM
ZUFSP	ENSG00000153975	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,635]
ZXDA	ENSG00000198205	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,636]
ZXDB	ENSG00000198455	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,637]
ZXDC	ENSG00000070476	C2H2 ZF	Likely sequence specific TF according to literature or domain structure – No motif [1,638]
ZZZ3	ENSG00000036549	Myb/SANT	Known motif – High-throughput in vitro [1,639]	SAATCCAW

References

^ Lambert, Samuel; Arttu, Jolma; Campitelli, Laura; Das, Pratyush; Yin, Yimeng; Albu, Mihai; Chen, Xiaoting; Taipale, Jussi; Hughes, Timothy; Weirauch, Matthew (February 2018). "The Human Transcription Factors". Cell. 172 (4): 650–665. doi:10.1016/j.cell.2018.01.029. PMID 29425488.

[1] Lambert, Samuel; Arttu, Jolma; Campitelli, Laura; Das, Pratyush; Yin, Yimeng; Albu, Mihai; Chen, Xiaoting; Taipale, Jussi; Hughes, Timothy; Weirauch, Matthew (February 2018). "The Human Transcription Factors". Cell. 172 (4): 650–665. doi:10.1016/j.cell.2018.01.029. PMID 29425488.

[1]